[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31447.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  148/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:180 amino acids
:PSIPRED
:RPS:PFM   15->109 PF03350 * UPF0114 5e-07 34.0 %
:HMM:PFM   15->134 PF03350 * UPF0114 6.5e-36 37.0 119/124  
:BLT:SWISS 12->172 Y4083_AZOVD 9e-17 27.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31447.1 GT:GENE ACD31447.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1764285..1764827 GB:FROM 1764285 GB:TO 1764827 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD31447.1 GB:DB_XREF GI:187713150 LENGTH 180 SQ:AASEQ MSKFINKILSIIEMFIFGIRWIQAPIYLLLSLVLFGFIYEIYHELYHLFTHYHTIDEDQLIIIALTLCDVVLVANLVVIVVISGYENFVSKMNLDKKSGGQPVWIKKLSPNAVKLKIAGSIIGISSISLLKKFLEVSQATDRDLAWSAAIHMVFVVSALLIAFTSFIEGKSHKASYDDDH GT:EXON 1|1-180:0| BL:SWS:NREP 1 BL:SWS:REP 12->172|Y4083_AZOVD|9e-17|27.0|159/164| TM:NTM 3 TM:REGION 15->37| TM:REGION 61->83| TM:REGION 145->167| SEG 70->82|vvlvanlvvivvi| SEG 114->134|klkiagsiigissisllkkfl| RP:PFM:NREP 1 RP:PFM:REP 15->109|PF03350|5e-07|34.0|94/124|UPF0114| HM:PFM:NREP 1 HM:PFM:REP 15->134|PF03350|6.5e-36|37.0|119/124|UPF0114| OP:NHOMO 153 OP:NHOMOORG 149 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------21111121112------------11-1111------------------1-----1--------------------1-------------------------------------1111-1111111111111111111-11111111--11111111--1-----11111-1--------11-11----------------------------------------------------------------1---1--111111-1111-1--1--1--------------11--------------------------------11-1-----1-111111111111111--1------------------------------------111----11111--1--------2-1111111----111111-1111111111-----11111-----11----------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccEEEEEEEcccccEEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccc //