[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31455.1
DDBJ      :             zinc-binding protein
Swiss-Prot:             

Homologs  Archaea  14/68 : Bacteria  804/915 : Eukaryota  82/199 : Viruses  0/175   --->[See Alignment]
c.97.1
:153 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   27->152 1z3aA PDBj 2e-30 46.0 %
:RPS:PDB   6->152 2b3jA PDBj 1e-34 38.8 %
:RPS:SCOP  7->153 1wwrA1  c.97.1.2 * 8e-32 31.3 %
:HMM:SCOP  1->153 1wkqA_ c.97.1.2 * 5.1e-46 42.0 %
:RPS:PFM   10->104 PF00383 * dCMP_cyt_deam_1 7e-15 39.4 %
:HMM:PFM   7->105 PF00383 * dCMP_cyt_deam_1 1.9e-24 33.7 98/102  
:BLT:SWISS 27->152 TADA_SHIFL 5e-30 46.0 %
:PROS 57->94|PS00903|CYT_DCMP_DEAMINASES
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31455.1 GT:GENE ACD31455.1 GT:PRODUCT zinc-binding protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1774991..1775452) GB:FROM 1774991 GB:TO 1775452 GB:DIRECTION - GB:PRODUCT zinc-binding protein GB:PROTEIN_ID ACD31455.1 GB:DB_XREF GI:187713158 LENGTH 153 SQ:AASEQ MSNYSDQDIFFMQKAYQQALLAYQAGEVPIGAVLVRDDQIIVQNFNQTIGLNDPTAHAEILVLRSAALKLGNYRLVNTKLYVTLEPCIMCLGGLIQARVPELVYACDDSRVGAFSREKLHHNKNINHNLGVTAGVMADECGKLLKDFFKQRRN GT:EXON 1|1-153:0| BL:SWS:NREP 1 BL:SWS:REP 27->152|TADA_SHIFL|5e-30|46.0|126/167| PROS 57->94|PS00903|CYT_DCMP_DEAMINASES|PDOC00702| SEG 13->25|qkayqqallayqa| SEG 118->129|klhhnkninhnl| BL:PDB:NREP 1 BL:PDB:REP 27->152|1z3aA|2e-30|46.0|126/156| RP:PDB:NREP 1 RP:PDB:REP 6->152|2b3jA|1e-34|38.8|147/151| RP:PFM:NREP 1 RP:PFM:REP 10->104|PF00383|7e-15|39.4|94/100|dCMP_cyt_deam_1| HM:PFM:NREP 1 HM:PFM:REP 7->105|PF00383|1.9e-24|33.7|98/102|dCMP_cyt_deam_1| GO:PFM:NREP 2 GO:PFM GO:0008270|"GO:zinc ion binding"|PF00383|IPR002125| GO:PFM GO:0016787|"GO:hydrolase activity"|PF00383|IPR002125| RP:SCP:NREP 1 RP:SCP:REP 7->153|1wwrA1|8e-32|31.3|147/151|c.97.1.2| HM:SCP:REP 1->153|1wkqA_|5.1e-46|42.0|150/0|c.97.1.2|1/1|Cytidine deaminase-like| OP:NHOMO 1063 OP:NHOMOORG 900 OP:PATTERN ------------------------1---11--1-----1111---1-1-2111--------------- 212-2-12---11112211-1-1121111112----11111121211111-133321-11--2111222111111111111111-111222211221--1111212111211111111111111122111111112----------1234221112211111212223331111111111111--111111111111111121111111212222111111121111111132111111--11111111111111112211111111122111112111111111111111111111111-1111111111111111111111111112222222222111111111121111111111111111111111--111111-11111121112132112111111111111-211112121111111112222211111111111---21111111111-11111211111111111111111111111111111--111111111111131111111111111111121122311111111112211121321111111111111111211221121111212111111111111111111111--------------------1---1111111111111111111111111111111111-1111111111111111111111111111-111111111111111111122211111111111111111111111111111111111111111111111222221111211111111111111111112222221111112222121111111111111111111111111111111111111111111111111111---1111----------111111------------------------------321 -----1-----------11---1----11--11111-111-1111----1-----------------------1---------------111-111--1-1-------22--11-31---111-1----121-111----11111-1---1--1-11----1-2--11---221-11112111123445121211-1-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 153 STR:RPRED 100.0 SQ:SECSTR ccccHHHHHHHHHHHHHHHHHHHHTTccccEEEEEETTEEEEEEEccHHHHTcTTccHHHHHHHHHHHHHTccccTTEEEEEEEcccHHHHHHHHHTTccEEEEEEccTTTccTTcccTTccTTcccccEEEccTTHHHHHHHHHHHHHHHHc PSIPRED cccccHHHHHHHHHHHHHHHHHHHcccccEEEEEEEccEEEEEEccccccccccccHHHHHHHHHHHHHHccccccccEEEEEccccHHHHHHHHHccccEEEEEEEccccccccHHHHHcccccccccEEEEccHHHHHHHHHHHHHHHHcc //