[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31458.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:178 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   116->166 PF08426 * ICE2 0.0003 30.0 50/418  
:HMM:PFM   36->101 PF05975 * EcsB 0.00049 23.4 64/386  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31458.1 GT:GENE ACD31458.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1778027..1778563 GB:FROM 1778027 GB:TO 1778563 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD31458.1 GB:DB_XREF GI:187713161 LENGTH 178 SQ:AASEQ MEKISHKDIQDKLWSNEDESNLSNEQYNSLLIEQYRIYVELTDRTSYRRIVINLFFLVFNLVLVGVVALAISNNINVENPPSSILVSIPYFAGLVFCYAWWKIIRFFRHHIQIKNSIVPSLERRLPSRVWLTEEHIAEEKGSFKPIRILEIYMPFIFMGIYTALFLFVEIAWLPHTLN GT:EXON 1|1-178:0| TM:NTM 3 TM:REGION 50->72| TM:REGION 83->105| TM:REGION 152->174| SEG 50->71|ivinlfflvfnlvlvgvvalai| HM:PFM:NREP 2 HM:PFM:REP 116->166|PF08426|0.0003|30.0|50/418|ICE2| HM:PFM:REP 36->101|PF05975|0.00049|23.4|64/386|EcsB| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 8-18| PSIPRED ccccHHHHHHHHHHccHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc //