[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31486.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:205 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   51->134 PF09850 * DUF2077 3e-04 28.6 %
:HMM:PFM   21->203 PF09850 * DUF2077 7e-14 21.1 180/206  
:BLT:SWISS 5->59 AXP83_CIOIN 8e-04 29.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31486.1 GT:GENE ACD31486.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1835363..1835980 GB:FROM 1835363 GB:TO 1835980 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD31486.1 GB:DB_XREF GI:187713189 LENGTH 205 SQ:AASEQ MKDFKEIEIILDIIKTTREIIEDNDNEKISYHRNNIRKSIFFLQEELLEKYSETVCKYIVFPLLAYVDEKLMLLREKSASNISWSLLQLEYYDRKDGGEYVFEITDNILSENIYPEICYQTISLILHNDFYGKYYDNIYNHSFLAYKKEIDKHIENSTIDSVNFIDIPVNSPPLSRKYSKTLKFLLRIGVPLGLFLLSLLILLSW GT:EXON 1|1-205:0| BL:SWS:NREP 1 BL:SWS:REP 5->59|AXP83_CIOIN|8e-04|29.1|55/100| TM:NTM 1 TM:REGION 181->203| SEG 192->203|lglfllsllill| RP:PFM:NREP 1 RP:PFM:REP 51->134|PF09850|3e-04|28.6|84/205|DUF2077| HM:PFM:NREP 1 HM:PFM:REP 21->203|PF09850|7e-14|21.1|180/206|DUF2077| OP:NHOMO 17 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------122222222---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 200-202,205-206| PSIPRED cccHHHHHHHHHHHHHHHHHHHcccccEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEEEEcccccEEHHEEEHHHHcccccHHHHHHHHHHHHHccHHHHHHHHHHccHHHHHHHHHHHHHHcccccccEEEEEccccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHcc //