[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31488.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:257 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31488.1 GT:GENE ACD31488.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1837119..1837892 GB:FROM 1837119 GB:TO 1837892 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD31488.1 GB:DB_XREF GI:187713191 LENGTH 257 SQ:AASEQ MKTILKIFLTYKQYWKILNMQHINNINKNISLNNFVSLLKSQKYSLKRINFIPVMINKTSSPTILDIYDNKETLNVKINIFKIKPFTKLQSIYQEYIQNNNDLAIEILGYGLKVLLKLYILDTKALHKFTTKNSYYIQCAPKYTIDNIINNIYKLLSEDYCTVIDYKEKLINIKRKQIVVGDSYVGKSFLGAYIPSYVYIINIKIYLISKNQYVINKIKTQIKKIEEKITNLPFKIELEISIENNKKNQIYLGYFNL GT:EXON 1|1-257:0| TM:NTM 1 TM:REGION 188->210| SEG 23->34|inninknislnn| SEG 107->121|ilgyglkvllklyil| SEG 215->231|inkiktqikkieekitn| OP:NHOMO 16 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------122221222---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 59-59,62-62,67-68,73-73,76-76,81-81,115-115,118-118,123-124,129-130,132-132,137-137,143-143,171-172,174-174,179-179,207-207,213-214,216-216,221-221,227-227,235-235,241-241,244-244| PSIPRED ccHHHHHHHHHHHHHHHHcHHHHccccccccHHHHHHHHHHccccEEEEEEEEEEEEcccccEEEEEEcccEEEEEEEEEEEEccHHHHHHHHHHHHcccccEEEEEEHHHHHHHHHHHEEcHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHcccccEEEEHHHHcccEEEEEEEEcccHHHHHHHHHHcccEEEEEEEEEEEEEccHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEcccccEEEEEEEcc //