[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31508.1
DDBJ      :             (putative) drug resistance ATPase-1 (Drug RA1) family protein
Swiss-Prot:             

Homologs  Archaea  67/68 : Bacteria  907/915 : Eukaryota  197/199 : Viruses  1/175   --->[See Alignment]
c.37.1e.26.1
:559 amino acids
:PSIPRED
:BLT:PDB   17->53 1xefA PDBj 8e-05 48.6 %
:BLT:PDB   32->519 3bk7A PDBj 5e-23 29.9 %
:RPS:PDB   15->533 3cmvA PDBj 2e-50 11.3 %
:RPS:SCOP  1->63 1e3mA2  c.37.1.12 * 6e-07 16.7 %
:RPS:SCOP  37->541 1mjgM  e.26.1.3 * 5e-32 8.2 %
:HMM:SCOP  9->241 1ii8.1 c.37.1.12 * 1.9e-47 32.6 %
:HMM:SCOP  213->391 1pujA_ c.37.1.8 * 5.7e-06 21.2 %
:HMM:SCOP  329->523 1ii8.1 c.37.1.12 * 2.8e-48 30.7 %
:RPS:PFM   202->293 PF00901 * Orbi_VP5 1e-04 26.4 %
:RPS:PFM   366->476 PF00005 * ABC_tran 2e-06 37.7 %
:HMM:PFM   47->194 PF00005 * ABC_tran 2.5e-18 44.4 90/118  
:HMM:PFM   366->476 PF00005 * ABC_tran 6.2e-18 29.9 107/118  
:HMM:PFM   339->384 PF03193 * DUF258 0.00069 22.2 45/161  
:BLT:SWISS 4->557 YJJK_SHIFL 0.0 63.2 %
:PROS 166->180|PS00211|ABC_TRANSPORTER_1
:REPEAT 2|19->258|338->541
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31508.1 GT:GENE ACD31508.1 GT:PRODUCT (putative) drug resistance ATPase-1 (Drug RA1) family protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1871639..1873318) GB:FROM 1871639 GB:TO 1873318 GB:DIRECTION - GB:PRODUCT (putative) drug resistance ATPase-1 (Drug RA1) family protein GB:PROTEIN_ID ACD31508.1 GB:DB_XREF GI:187713211 LENGTH 559 SQ:AASEQ MAEKYIYSMHRVGKVVPPNKYILKDISLSFFDGAKIGVLGLNGSGKSTLLKIMAGIDTEIVGEAVPRKGVKVGYLPQEPKLDPTKDVRGNVEEALAHLQDMLTRFDEISMKFCEPMSDDEMAKLLEEQGELQNAIDAAGAWEIERKLEVAAEALRLPPWDADVTKLSGGEARRVALCKLLLSAPDILLLDEPTNHLDAESVAWLEKFLAEYKGTVVAVTHDRYFLDNVAEWILELDRGEGIPFKGNYSQWLEQKQKRLEIEEKRETAHQKALKEELEWVRQNVKGRQAKSKARLAKFDELSSQEFQKRNETQELYIPPGERLGNNVIKVKDLVKSFDDKLLIDGLDMDVYPGSIVGIIGANGAGKSTFFKMLTGKETPDSGEIKIGEAVHLAYVDQSRDALDDNKTVWEEIADGLDVITVGKYTIPSRQYVGRFNFKGADQQKYISQLSGGERNRVHLAKLLRSGGNVILLDEPTNDLDVETLRALEEAILAFPGCIMVISHDRWFLNRIATHMLAFEGNSEVVWFEGNYDAYIEDKKRRLGDKYDAITKIKYKRISVD GT:EXON 1|1-559:0| BL:SWS:NREP 1 BL:SWS:REP 4->557|YJJK_SHIFL|0.0|63.2|552/555| PROS 166->180|PS00211|ABC_TRANSPORTER_1|PDOC00185| NREPEAT 1 REPEAT 2|19->258|338->541| SEG 179->189|lllsapdilll| BL:PDB:NREP 2 BL:PDB:REP 17->53|1xefA|8e-05|48.6|37/241| BL:PDB:REP 32->519|3bk7A|5e-23|29.9|421/593| RP:PDB:NREP 1 RP:PDB:REP 15->533|3cmvA|2e-50|11.3|503/1190| RP:PFM:NREP 2 RP:PFM:REP 202->293|PF00901|1e-04|26.4|87/507|Orbi_VP5| RP:PFM:REP 366->476|PF00005|2e-06|37.7|106/123|ABC_tran| HM:PFM:NREP 3 HM:PFM:REP 47->194|PF00005|2.5e-18|44.4|90/118|ABC_tran| HM:PFM:REP 366->476|PF00005|6.2e-18|29.9|107/118|ABC_tran| HM:PFM:REP 339->384|PF03193|0.00069|22.2|45/161|DUF258| GO:PFM:NREP 4 GO:PFM GO:0005198|"GO:structural molecule activity"|PF00901|IPR000145| GO:PFM GO:0019028|"GO:viral capsid"|PF00901|IPR000145| GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 2 RP:SCP:REP 1->63|1e3mA2|6e-07|16.7|63/223|c.37.1.12| RP:SCP:REP 37->541|1mjgM|5e-32|8.2|489/728|e.26.1.3| HM:SCP:REP 9->241|1ii8.1|1.9e-47|32.6|230/370|c.37.1.12|1/2|P-loop containing nucleoside triphosphate hydrolases| HM:SCP:REP 213->391|1pujA_|5.7e-06|21.2|151/273|c.37.1.8|2/2|P-loop containing nucleoside triphosphate hydrolases| HM:SCP:REP 329->523|1ii8.1|2.8e-48|30.7|192/370|c.37.1.12|2/2|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 18169 OP:NHOMOORG 1172 OP:PATTERN 65829356898777CAJ164574CI99ACDD8A56696568759GBED9CMGE5BD9BC7A5549-37 BBI5eHGKLLLEHGI99AA-AJ33BZAAAAAAKPQQJaghCB9KKXMHIIF9WSSAFF66GJPDRPPochCEBBBRIGNAPFH44655FFEC1C335-167E788FDE5B212212145544448573669464A6AIIJJ556JDDC8GFEFAB99958757DCAHNON9666746586875C7A43FD59JVhhkhjdgtcppmgjmXSVVUQnqjLILYVKYPRQQPQelHKLNMNKKLLKKKKKJEDFGKFCEOPDEEFKQNCCTQJEBILGIKJLKKOQKSMLNNOONMMPNOMNIHJIJIKIMHIHJQPQJJIQORLDZSVighgllgiRfRNRRQEKLJjRIITPIFE4mjLK9GHD9CIFJF7II98ICEE986767D8nhlA9HTOKLMPQQOPPRNOPx-IIOHEPGKO*85***sv*v*****aN898ORfMHMPWMOAAAAAAAAPCC99EAO112-2222224343663464434443232466779KRMIIVTTUUUIKIJHUUacMMLLGKYTpKGOM3BLMGM9DDEPIUSSY9IC8A84G7DBEDEEEAB7BC8JFS8GABCAEOAAB7GFFCDCFAEECCDNPEFAB8E65465463422222226745886DDQBEAAB77ICBDEC9BHCCCE9DJDEFE1-6579811-111UNdWFWKLNNMLOLOJK-NKLLMKNKMKNNKLLKLLLdieZfEILJMIJJJKKKKJHKHJIVHGDGGHJB2TUWXZaYWVZYZ228646555ABAAA8QGXJJJLGH6CDBCDCEJGHIIH9C99BIEEEFFFMQSJJJINENNQ967689876AINMOJKJKKOUOLK99A97A98988777349C88AA9954451454J6A64444-2333211CBB354343222CIFB8DOFED2F7 1211959-C3336896655555566675555547665756745545556667775766644454544444444545625544444455-6776555465454778918X6BBE9EBA86746C5LN5L5p*F1FAN4534E55BE58764C43c4J87G7Id3G4849CEO5DA95ACJ*FCH7ADAKN5DADGIAGEF ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--- PSIPRED ccccEEEEEEccEEEEccccEEEEccEEEEccccEEEEEccccccHHHHHHHHcccccccccEEEEccccEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHccHHHccHHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHHHccccEEEEEccHHHHHHHccEEEEEEccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEcccccccccEEEEEccEEEEccEEEEEccEEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEEEEEEcccHHHccccccHHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHccHHHccHHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHHHcccEEEEEcccHHHHHHHccEEEEEEcccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //