[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31511.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  291/915 : Eukaryota  146/199 : Viruses  0/175   --->[See Alignment]
d.157.1
:326 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   64->301 3bv6A PDBj 9e-19 16.2 %
:RPS:SCOP  68->282 1smlA  d.157.1.1 * 1e-13 11.6 %
:HMM:SCOP  71->302 1ycgA2 d.157.1.3 * 6.9e-35 21.2 %
:HMM:PFM   116->132 PF00753 * Lactamase_B 7.6e-05 47.1 17/194  
:HMM:PFM   36->45 PF09689 * PY_rept_46 0.00022 70.0 10/46  
:BLT:SWISS 13->99 BCH1_YEAST 7e-04 33.3 %
:BLT:SWISS 70->325 NAPEP_HUMAN 4e-47 37.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31511.1 GT:GENE ACD31511.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1875332..1876312 GB:FROM 1875332 GB:TO 1876312 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD31511.1 GB:DB_XREF GI:187713214 LENGTH 326 SQ:AASEQ MVKVISINNFTKNKFSNPPGSPMRKGGSRDFLKFIFSSMFKKHKKVFPRDHVLEKQQALEQLNNASNYSITWLGHAAFLIKLNEYFIITDPFLSKNAGPGFLGPKREIYSPLNLSDIPKIDMIIISHNHYDHLDSKLIKNFPNKENIKVIVPIGLSSFFIKRGFKNVTEMGWWQQIDINDITIGCLPCVHFSGRGLFDRNKTLWASFSIKDKNKKVWFSGDTAYGEIFKEIGKKEEYFDLALIGIGAYEPRDFMCSVHATPEEAIQIAKDIKATKTIGMHWGTIRLTPEPFFEPPKRFKQAAKDQKYGQENALILKIGETINLENY GT:EXON 1|1-326:0| BL:SWS:NREP 2 BL:SWS:REP 13->99|BCH1_YEAST|7e-04|33.3|84/724| BL:SWS:REP 70->325|NAPEP_HUMAN|4e-47|37.5|256/393| SEG 224->238|ygeifkeigkkeeyf| SEG 288->295|pepffepp| RP:PDB:NREP 1 RP:PDB:REP 64->301|3bv6A|9e-19|16.2|234/353| HM:PFM:NREP 2 HM:PFM:REP 116->132|PF00753|7.6e-05|47.1|17/194|Lactamase_B| HM:PFM:REP 36->45|PF09689|0.00022|70.0|10/46|PY_rept_46| RP:SCP:NREP 1 RP:SCP:REP 68->282|1smlA|1e-13|11.6|189/266|d.157.1.1| HM:SCP:REP 71->302|1ycgA2|6.9e-35|21.2|208/0|d.157.1.3|1/1|Metallo-hydrolase/oxidoreductase| OP:NHOMO 564 OP:NHOMOORG 443 OP:PATTERN -----------------1-----1--------------------------21---1-1---------- 222-----------11111-11--1111111111111111--------------------12--111221---------------1--121--1-----112-1-321-2--------------1-------------------1----------------------------------------------111222222211122221-211--322111--12------12--------------------------------------------------------------------------------------------1-2-------1-1------------------11---------------2-----------11111---11111------------11111111-11-11111111111-11---------------------1-11--11-------------111-121---------1----------1111111----1111------112--------2--1--1---1--1-----1--------------22-11-1---1----11---1-1---1-5411-1---1111---1-----------1----41--1111-1-1---1-111-1--1--1--1----------1112-11-------------------------------1111-------------------1---------111111111111---------1111-13-1---112-------1-22222-1--11111121111--1---1111-111111---11111111111111111111---2111--1-221111---------------------------------------1-1111112- 22--22--31--112222111111211--------11111111---1111111111112122111111111111111111111111---2-121114343114222-1-2-121113-11-11132111761-1111-111111211111111111111----2--------431111-----11--1-2-1121---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 309 STR:RPRED 94.8 SQ:SECSTR ##############cccTTcccccEcGGGGGGTTccccccTTccHHHHHHHHHTTccEEEEEEcTTcEEEEEEETTEEEEEETTccEEEEcccccHcccccccccccccccccGGGcccccEEEcccccGGGccHHHHHHHHccTTcEEEEcHHHHHHHHHHTGGGEEEccTTcEEEETTEEEEEEEcccHHHHTccGcHHHHcEEEEEEETTEEEEEcTTccccTTHHHHHHHccccEEEEEccccccTTcTTccccccHHHHHHHHHHHTccEEEEEcTTccGGGcccTHHHHHHHHHHHHHHHTTcccEEEccTTcEEEc### DISOP:02AL 326-327| PSIPRED cccEEcccccccccEEcccccccccccHHHHHHHHHHHHHccccccccccccccccccHHHHcccccEEEEEEEccEEEEEEccEEEEEccccccccccccccccEEccccccHHHcccccEEEEEcccHHHccHHHHHHHHcccccEEEEcHHHHHHHHHcccccEEEcccccEEEEccEEEEEEEEEEccccccccccccccEEEEEEEccEEEEEEccccccHHHHHHHHHcccccEEEEEccccccccccccccccHHHHHHHHHHccccEEEEEEccccccccccccccHHHHHHHHHHcccccccEEEcccccEEEEccc //