[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31513.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:106 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   18->78 PF05818 * TraT 0.00016 19.7 61/215  
:BLT:SWISS 6->68 SYR_STRU0 2e-04 36.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31513.1 GT:GENE ACD31513.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1879479..1879799 GB:FROM 1879479 GB:TO 1879799 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD31513.1 GB:DB_XREF GI:187713216 LENGTH 106 SQ:AASEQ MINPMLKKIDQIRNEISKFPEELKAELKEQGFDINNDQHVYDLYIETKEAKKSQAENANQILSEAELDSISGGAQGIDWKKSQKAKRLKEIMENTNHYRPVRHRPG GT:EXON 1|1-106:0| BL:SWS:NREP 1 BL:SWS:REP 6->68|SYR_STRU0|2e-04|36.5|63/562| HM:PFM:NREP 1 HM:PFM:REP 18->78|PF05818|0.00016|19.7|61/215|TraT| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1----1---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 106-107| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHccccccccccccc //