[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31515.1
DDBJ      :             heat shock protein, HSP20 family
Swiss-Prot:             

Homologs  Archaea  15/68 : Bacteria  389/915 : Eukaryota  50/199 : Viruses  0/175   --->[See Alignment]
b.15.1
:142 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   41->129 3glaB PDBj 7e-11 36.0 %
:RPS:PDB   42->132 2byuA PDBj 1e-18 33.0 %
:RPS:SCOP  38->140 1gmeB  b.15.1.1 * 4e-22 34.0 %
:HMM:SCOP  10->142 1gmeA_ b.15.1.1 * 4.4e-32 30.1 %
:RPS:PFM   42->141 PF00011 * HSP20 1e-15 46.0 %
:HMM:PFM   42->140 PF00011 * HSP20 4.6e-30 32.3 99/102  
:BLT:SWISS 8->123 HSPC4_RICFE 1e-21 42.2 %
:BLT:SWISS 96->142 HSPK_DICDI 8e-05 42.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31515.1 GT:GENE ACD31515.1 GT:PRODUCT heat shock protein, HSP20 family GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1883708..1884136 GB:FROM 1883708 GB:TO 1884136 GB:DIRECTION + GB:PRODUCT heat shock protein, HSP20 family GB:PROTEIN_ID ACD31515.1 GB:DB_XREF GI:187713218 LENGTH 142 SQ:AASEQ MSKEIRYNPFELKHSINDLFDNFFSFPKSYQEEKYLENIHLDITEDEAAYNISADLAGIEEKDIDIELDKNKLSIKAKREYLDKDKKHHIQERYYGEFQRSITLPDNIDSDKIEAKYSNGVLSLNIPKKEKDNTTKKISIKS GT:EXON 1|1-142:0| BL:SWS:NREP 2 BL:SWS:REP 8->123|HSPC4_RICFE|1e-21|42.2|116/163| BL:SWS:REP 96->142|HSPK_DICDI|8e-05|42.6|47/179| BL:PDB:NREP 1 BL:PDB:REP 41->129|3glaB|7e-11|36.0|89/99| RP:PDB:NREP 1 RP:PDB:REP 42->132|2byuA|1e-18|33.0|91/101| RP:PFM:NREP 1 RP:PFM:REP 42->141|PF00011|1e-15|46.0|100/101|HSP20| HM:PFM:NREP 1 HM:PFM:REP 42->140|PF00011|4.6e-30|32.3|99/102|HSP20| RP:SCP:NREP 1 RP:SCP:REP 38->140|1gmeB|4e-22|34.0|103/109|b.15.1.1| HM:SCP:REP 10->142|1gmeA_|4.4e-32|30.1|133/0|b.15.1.1|1/1|HSP20-like chaperones| OP:NHOMO 738 OP:NHOMOORG 454 OP:PATTERN -----------------------1----1---1-1----------1-21-111-111--11------- -12-1---------14311-1-11221111112122-123211-1----11212111-----1--112--2-------1-1-211121--1111-----1-2-1121232---------------22122222212111221-11133232221111-------11-3263------------1111111--1---------1--1-----11-----111------------1111-111111111-1-----1-122111112211221-1-11------------------------------------------1-------112221221-2-1-111----12--113-112--2-1-1-1111----122--4-----1-41333211-11----------3-142-322111------1141-1-2-------1-1-----11111111111--1--------------------3-1------11-1--4------422223423334424333323127232---531-1111-112--2-131-11--------11321136131325112--1-31332211112322-461---1---------------2111211--1-21--1-21-----------1----1----2112-------------------------------------------1------------------------------------------------11111111222-21--------------------------21---------2-1-1----111111111----------------111111111111--31111111-----1--1---------------------------1-1111111111- 1---122-211---4-----11-2121----------211111-----------------------1-1-------11112-----27-532-154-----2-1---1-4-----------------------------------------------------------------2--2-22121438--4-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 138 STR:RPRED 97.2 SQ:SECSTR cccccGGGEEEETTTEEEEEcccccccccccccccEEEEEEEEEEcccEEEEEEEcTTccGGGEEEEETTTEEEEEEccccccTTccccccccccccEEEEEEccccccGGGcEEEEETTEEEEEEEccccccccccc#### PSIPRED ccccccccHHHHHHHHHHHHHHHccccccccccccccccEEEEEEcccEEEEEEEEccccHHHEEEEEEccEEEEEEEEccccccccEEEEEEEEEEEEEEEEccccccHHHEEEEEEccEEEEEEEccccccccEEEEEEc //