[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31517.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  32/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.60.1
:137 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->122 3gk6A PDBj 1e-06 28.3 %
:RPS:SCOP  1->122 1jyhA  d.60.1.3 * 1e-08 13.8 %
:HMM:PFM   2->124 PF06445 * AraC_E_bind 5.8e-08 20.2 119/154  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31517.1 GT:GENE ACD31517.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1885586..1885999) GB:FROM 1885586 GB:TO 1885999 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD31517.1 GB:DB_XREF GI:187713220 LENGTH 137 SQ:AASEQ MKVVGIASKVSNDREDLLEEAWELFFNSEVLEYLNSQNISQDIISVYYEYEGDYTAPYTLLIGYEVPEPFEVPTGLNSVQIELNHQTYRVEGELPDAIIDKWQQIWADNSKKRAYKADFDRYNPIEDYAEVNVEYLK GT:EXON 1|1-137:0| BL:PDB:NREP 1 BL:PDB:REP 2->122|3gk6A|1e-06|28.3|113/149| HM:PFM:NREP 1 HM:PFM:REP 2->124|PF06445|5.8e-08|20.2|119/154|AraC_E_bind| RP:SCP:NREP 1 RP:SCP:REP 1->122|1jyhA|1e-08|13.8|116/155|d.60.1.3| OP:NHOMO 32 OP:NHOMOORG 32 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------1----1---1--------------------------------------------------------------------------------1----------------1--1----------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--1----------------------------------------------------------------1----------------------1-------------------------------1--------------------------------------1111---1111-1--1------------------------------------------------------------------------------------------------------------1---------------------------------------------------1111-1111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 132 STR:RPRED 96.4 SQ:SECSTR cEEEEEEEEEcHHHHHHHHHHHHHH###HHHHHHHHTTcccccEEEEEcTTccEEEEEEEEccccccccTTcEEEEEEEEcEcccEEEEEEccGGGHTHHHHHHHHHHHTTccEEEEEEEEE##cccTTcccGGGcE PSIPRED cEEEEEEEEEccccHHHHHHHHHHHHccccccccccccccccEEEEEEcccccccccEEEEEEEEEccHHHcccccEEEEEEccEEEEEEccccHHHHHHHHHHHHHcccccccccccEEEEcccccEEEEEEHHcc //