[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31519.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:146 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31519.1 GT:GENE ACD31519.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1887547..1887987) GB:FROM 1887547 GB:TO 1887987 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD31519.1 GB:DB_XREF GI:187713222 LENGTH 146 SQ:AASEQ MLYFKYKYKNLFKINVIEKYIQLFTQLKMDESLFLPDGQELCPADGSRTLVEYARGLPKESYQYIQRIKLKELICKNANVDGQIELHGIARFKLYWKVNKGQAKMTMVQVLHSKNGIIYYLNSFCDFEYFTKLCEIHPELKKIFQK GT:EXON 1|1-146:0| SEG 2->13|lyfkykyknlfk| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 8-18,146-147| PSIPRED cEEEEEEcccEEEHHHHHHHHHHHHHHcccccEEcccccccccccccEEHHHHHHcccHHHHHHHHHHHHHHHHHcccccccEEEEEEEEEEEEEEEEccccHHHHHHHHHHccccEEEEEEccccHHHHHHHHHHcHHHHHHHcc //