[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ampD
DDBJ      :ampD         N-acetylmuramoyl-L-alanine amidase, protein AmpD
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  382/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
d.118.1
:174 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->169 1iyaA PDBj 2e-46 48.5 %
:RPS:PDB   1->173 3d2zA PDBj 7e-40 33.1 %
:RPS:SCOP  1->171 1j3gA  d.118.1.1 * 4e-43 48.0 %
:HMM:SCOP  1->175 1j3gA_ d.118.1.1 * 7.8e-56 47.4 %
:RPS:PFM   27->164 PF01510 * Amidase_2 7e-24 57.9 %
:HMM:PFM   19->165 PF01510 * Amidase_2 4.2e-30 40.8 120/130  
:BLT:SWISS 1->169 AMPD_ECOLI 4e-46 49.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30303.1 GT:GENE ampD GT:PRODUCT N-acetylmuramoyl-L-alanine amidase, protein AmpD GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 248997..249521 GB:FROM 248997 GB:TO 249521 GB:DIRECTION + GB:GENE ampD GB:PRODUCT N-acetylmuramoyl-L-alanine amidase, protein AmpD GB:PROTEIN_ID ACD30303.1 GB:DB_XREF GI:187712006 GB:GENE:GENE ampD LENGTH 174 SQ:AASEQ MFNQGWYKKAKCIKSPNFNQRADKNDINLVVIHCISLPEGGYANCNVEKFFTNQLDCSLHPSFASLKGVEVSAHFYIKRDGEIVQFVSVDDRAWHAGVSEFQGWQGCNDFSVGIELQGTDKTAYTEQQYLSLNSLLKDLRKAYPTLLNITGHEDIAPQRKTDPGKCFEWNKVIW GT:EXON 1|1-174:0| BL:SWS:NREP 1 BL:SWS:REP 1->169|AMPD_ECOLI|4e-46|49.7|169/183| BL:PDB:NREP 1 BL:PDB:REP 1->169|1iyaA|2e-46|48.5|169/187| RP:PDB:NREP 1 RP:PDB:REP 1->173|3d2zA|7e-40|33.1|148/256| RP:PFM:NREP 1 RP:PFM:REP 27->164|PF01510|7e-24|57.9|114/129|Amidase_2| HM:PFM:NREP 1 HM:PFM:REP 19->165|PF01510|4.2e-30|40.8|120/130|Amidase_2| GO:PFM:NREP 2 GO:PFM GO:0008745|"GO:N-acetylmuramoyl-L-alanine amidase activity"|PF01510|IPR002502| GO:PFM GO:0009253|"GO:peptidoglycan catabolic process"|PF01510|IPR002502| RP:SCP:NREP 1 RP:SCP:REP 1->171|1j3gA|4e-43|48.0|171/187|d.118.1.1| HM:SCP:REP 1->175|1j3gA_|7.8e-56|47.4|175/187|d.118.1.1|1/1|N-acetylmuramoyl-L-alanine amidase-like| OP:NHOMO 555 OP:NHOMOORG 385 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------1------------1-------------1--1-1---1---1--------------------------111-----------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------1----32--------------1---111121--1111111121111111111111111-111111--111-11111111111111111-111-11111--------1---1111------------11--11111-11-1-1-11111-22212222222233332212333323221111111111111111111111111111211111111111111----------------------------1----------------------------11221111112111111111111111111111--11111------22224232222222222-2222222222222222222222121122322222222222222222222222-233333333333--2111111----1112-111111111111111111111112221334322232222222221111111111211111111111112112122111----1-1-------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1-------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 174 STR:RPRED 100.0 SQ:SECSTR EEEETTEEEEccccccccccccccccccEEEEEEccccTTccccHHHHHHHHccccccHHHHHHHHTcccccccEEETTEEccEEcccTTcccccccccEETTEEcTTTTEEEEEEccccEEEccHHHHHHHHHHHHHHHHHHTcGGGEEEHHHHcTTTccTTcTTccHHHHHc DISOP:02AL 174-175| PSIPRED cccccccccEEEccccccccccccccccEEEEEcccccccHHHHHHHHHHHcccccHHHcHHHHHcccccEEEEEEEcccccEEEEccHHHHHHHcccccccccccccccEEEEEEEccccccccHHHHHHHHHHHHHHHHHcccHHHEEEcccccccccccccccccHHHHcc //