[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : bioC
DDBJ      :bioC         biotin synthesis protein BioC
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  21/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:245 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   69->186 3dr5A PDBj 2e-04 13.2 %
:HMM:SCOP  68->211 1xxlA_ c.66.1.41 * 5.7e-08 19.9 %
:HMM:PFM   69->141 PF08241 * Methyltransf_11 4.5e-06 16.7 66/95  
:BLT:SWISS 98->241 BIOC_HAEIN 7e-06 23.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30800.1 GT:GENE bioC GT:PRODUCT biotin synthesis protein BioC GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(926279..927016) GB:FROM 926279 GB:TO 927016 GB:DIRECTION - GB:GENE bioC GB:PRODUCT biotin synthesis protein BioC GB:PROTEIN_ID ACD30800.1 GB:DB_XREF GI:187712503 GB:GENE:GENE bioC LENGTH 245 SQ:AASEQ MSIYDQIRGNFSKATEYSKNSAIQNQVRQLLLEQTLNYSRLVNYNHINIILNLGVRDLSEPSELNRIFSPNQIDACDIALSKNSHNMSNIKMLKINFDKDLRLLKNDYDLIFSNMSFQWSQNIEKLIRNLTKKLNNRAILAFTTLLDKNFHQIKDILRVNKMHSCSNILDFIKRSNLKCLHHEDLYLDVRFNNFRELANHLKSTGVNTYTGNDNKQNFSSIRKLCLSSNHINLSYHVGLFICFKE GT:EXON 1|1-245:0| BL:SWS:NREP 1 BL:SWS:REP 98->241|BIOC_HAEIN|7e-06|23.6|144/260| RP:PDB:NREP 1 RP:PDB:REP 69->186|3dr5A|2e-04|13.2|106/213| HM:PFM:NREP 1 HM:PFM:REP 69->141|PF08241|4.5e-06|16.7|66/95|Methyltransf_11| HM:SCP:REP 68->211|1xxlA_|5.7e-08|19.9|141/0|c.66.1.41|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 21 OP:NHOMOORG 21 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1---1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--11-----------------------------------------------------------------------------------------------------------------------------------------------------11111-----------------------------------------------------111111111-----------------------------1---------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 106 STR:RPRED 43.3 SQ:SECSTR ####################################################################cHHHHHHHHHHHHHTTccGGGEEEEcccHHHHGGccTTcEEEEEEcccTTHHHHHHHHHHHEEE###EEEEEETTTTGGG#########TccccccccHHHHHHHHHHHHHTTcTTEE########################################################### DISOP:02AL 245-246| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHHccccEEEEEEccHHHHHHccccccEEEEccHHccccccccccEEEEEHHHHHcccHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHcccccHHHHHHHHHHcccccEEEEccEEEEEcccHHHHHHHHHHccccEEccccccccccHHHHHHHHccccEEEEEEEEEEEEcc //