[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : capC
DDBJ      :capC         capsule biosynthesis protein CapC
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:154 amino acids
:PSIPRED
:HMM:PFM   72->106 PF11188 * DUF2975 0.00059 22.9 35/93  
:BLT:SWISS 29->131 CAPC_BACSU 3e-10 50.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30941.1 GT:GENE capC GT:PRODUCT capsule biosynthesis protein CapC GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1109194..1109658) GB:FROM 1109194 GB:TO 1109658 GB:DIRECTION - GB:GENE capC GB:PRODUCT capsule biosynthesis protein CapC GB:PROTEIN_ID ACD30941.1 GB:DB_XREF GI:187712644 GB:GENE:GENE capC LENGTH 154 SQ:AASEQ MDPLTLSIGIGLVVGLVFVSLLGLSTGGMVVPGYFALEMGAPDRVIVTIIISIIIFGIVRFMSKFMIIYGRRRIAITVLLSFILGTVCNMLFSQYLTTSFYSNQVQVIGYIIPGLITLSIDRQGLIETIGSLLIASIIIRLLLIVLIGPEIVGI GT:EXON 1|1-154:0| BL:SWS:NREP 1 BL:SWS:REP 29->131|CAPC_BACSU|3e-10|50.0|100/149| TM:NTM 5 TM:REGION 10->32| TM:REGION 45->67| TM:REGION 74->96| TM:REGION 100->122| TM:REGION 129->151| SEG 4->28|ltlsigiglvvglvfvsllglstgg| SEG 45->59|vivtiiisiiifgiv| SEG 132->147|lliasiiirlllivli| HM:PFM:NREP 1 HM:PFM:REP 72->106|PF11188|0.00059|22.9|35/93|DUF2975| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHcccccccccHHccEEEEEEEEccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //