[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : cscK
DDBJ      :cscK         ROK family protein
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  173/915 : Eukaryota  22/199 : Viruses  0/175   --->[See Alignment]
c.55.1
:299 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->289 1xc3A PDBj 1e-60 45.0 %
:RPS:PDB   2->296 3bp8A PDBj 2e-32 14.7 %
:RPS:SCOP  3->123 1woqA1  c.55.1.10 * 2e-20 22.4 %
:RPS:SCOP  125->298 1xc3A2  c.55.1.10 * 5e-34 39.3 %
:HMM:SCOP  1->297 1sz2A1 c.55.1.7 * 3e-46 33.7 %
:RPS:PFM   5->189 PF00480 * ROK 8e-16 30.7 %
:HMM:PFM   5->189 PF00480 * ROK 1.1e-52 33.1 178/179  
:BLT:SWISS 3->289 SCRK_BACSU 4e-60 45.0 %
:PROS 133->158|PS01125|ROK
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31187.1 GT:GENE cscK GT:PRODUCT ROK family protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1443207..1444106 GB:FROM 1443207 GB:TO 1444106 GB:DIRECTION + GB:GENE cscK GB:PRODUCT ROK family protein GB:PROTEIN_ID ACD31187.1 GB:DB_XREF GI:187712890 GB:GENE:GENE cscK LENGTH 299 SQ:AASEQ MYLAGIEAGGTKFFTTIGDFDGNVIERHRTDTTTPEKTMSEVLKVLKDYQNKYDIKTIGLACFGPIDINPNSKTYGYITNTPKIAWQNFDIVNAVKTIFSGPIGFNTDVNAAAICEKLWGCAQDLENLLYLTVGTGVGGGIICNNKLVQGAMHPEIGHLLIPQNPLDEFKGSCPFHGNCLEGLASGTAINQRWKVAHAGALNDDHIAWQFEAEYLAKAIVNYICSFSPERIILGGGVMHKTILFDMIRKNVTKYLNNYLDYPALKDMTKFIVPASFGDNTGVKGSLALALETFNNSQAY GT:EXON 1|1-299:0| BL:SWS:NREP 1 BL:SWS:REP 3->289|SCRK_BACSU|4e-60|45.0|282/299| PROS 133->158|PS01125|ROK|PDOC00866| SEG 132->142|tvgtgvgggii| BL:PDB:NREP 1 BL:PDB:REP 3->289|1xc3A|1e-60|45.0|282/295| RP:PDB:NREP 1 RP:PDB:REP 2->296|3bp8A|2e-32|14.7|285/381| RP:PFM:NREP 1 RP:PFM:REP 5->189|PF00480|8e-16|30.7|176/181|ROK| HM:PFM:NREP 1 HM:PFM:REP 5->189|PF00480|1.1e-52|33.1|178/179|ROK| RP:SCP:NREP 2 RP:SCP:REP 3->123|1woqA1|2e-20|22.4|116/129|c.55.1.10| RP:SCP:REP 125->298|1xc3A2|5e-34|39.3|173/176|c.55.1.10| HM:SCP:REP 1->297|1sz2A1|3e-46|33.7|279/0|c.55.1.7|1/1|Actin-like ATPase domain| OP:NHOMO 235 OP:NHOMOORG 201 OP:PATTERN --1-1-----------1--------------------------------------------111---- --1------------------------------------1-----------1--1-------1----111---------------1----1---------------1-----------------------------111-----2------------------1------------------------1----211111111-111111111133111211-1--111111-1--------------------121----121232-21-11221111111111111111111111111111111111111111111111112---151111111211--11-11111-1------------2-1-122--11---211---------------------------------------------------------1----------------------------------------------------------111-1--------------------------------------------------------------------------------1------------------------------------------------------2----1----------------------------------1--------------------------------------------------------------------1---------------------------------1---------------------------------------111111111----------------------------------------1---1------------------------------1-11--1----1- ----111------------------------------------------------------------------------------------------------------1--------1----------------2--------------1--1-------------------1-1--13111---------1121231 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 296 STR:RPRED 99.0 SQ:SECSTR cEEEEEEEcccEEEEEEEETTccEEEEEEEEccccccHHHHHHHHHHHHHHHTTTTccEEEEEEEEEccEEETTTTEEEEccccccccccTTTHHHHTTcccEEEEEHHHHHHHHHHHccTTTTcccEEEEEEcccEEEEEEETTEEccccccccGGGccccccccccccccccccccccTTTccHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcGGGGHHHHHHHHHHHHHHHccHHHHTTccHHHHHTEEEccccTTcGGGGHHHHHHHHHccT### DISOP:02AL 299-300| PSIPRED cEEEEEEEcccEEEEEEEcccccEEEEEEEEcccHHHHHHHHHHHHHHHHHHccccEEEEEEEcccccccccEEEEEEEcccccccccccHHHHHHHHHcccEEEEEcHHHHHHHHHHccccccccEEEEEEEccccEEEEEEccEEEcccccccccEEEEcccccccccccccccHHHHHHHHccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcHHHccHHHHHHHHHHHHHHHHHccccccccccccEEEEcccccHHHHHHHHHHHHHHHHccccc //