[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : cspA
DDBJ      :cspA         cold shock protein, DNA-binding
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  683/915 : Eukaryota  28/199 : Viruses  1/175   --->[See Alignment]
b.40.4
:67 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   4->67 1mjcA PDBj 3e-17 57.8 %
:RPS:PDB   1->67 1c9oA PDBj 4e-17 45.5 %
:RPS:SCOP  1->67 1c9oA  b.40.4.5 * 2e-17 45.5 %
:HMM:SCOP  1->68 1h95A_ b.40.4.5 * 5.1e-24 55.9 %
:RPS:PFM   4->64 PF00313 * CSD 3e-14 59.0 %
:HMM:PFM   1->66 PF00313 * CSD 2.1e-29 51.5 66/67  
:BLT:SWISS 1->66 Y4CH_RHISN 2e-19 60.6 %
:PROS 15->34|PS00352|COLD_SHOCK

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30734.1 GT:GENE cspA GT:PRODUCT cold shock protein, DNA-binding GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(832524..832727) GB:FROM 832524 GB:TO 832727 GB:DIRECTION - GB:GENE cspA GB:PRODUCT cold shock protein, DNA-binding GB:PROTEIN_ID ACD30734.1 GB:DB_XREF GI:187712437 GB:GENE:GENE cspA LENGTH 67 SQ:AASEQ MRQGTVKFFNTSKGFGFIEPQDGGKDVFVHISAVENAGLSSLREGEKVSFEVEENRGKMAAVNIKSI GT:EXON 1|1-67:0| BL:SWS:NREP 1 BL:SWS:REP 1->66|Y4CH_RHISN|2e-19|60.6|66/69| PROS 15->34|PS00352|COLD_SHOCK|PDOC00304| BL:PDB:NREP 1 BL:PDB:REP 4->67|1mjcA|3e-17|57.8|64/69| RP:PDB:NREP 1 RP:PDB:REP 1->67|1c9oA|4e-17|45.5|66/66| RP:PFM:NREP 1 RP:PFM:REP 4->64|PF00313|3e-14|59.0|61/67|CSD| HM:PFM:NREP 1 HM:PFM:REP 1->66|PF00313|2.1e-29|51.5|66/67|CSD| GO:PFM:NREP 2 GO:PFM GO:0003677|"GO:DNA binding"|PF00313|IPR002059| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00313|IPR002059| RP:SCP:NREP 1 RP:SCP:REP 1->67|1c9oA|2e-17|45.5|66/66|b.40.4.5| HM:SCP:REP 1->68|1h95A_|5.1e-24|55.9|68/0|b.40.4.5|1/1|Nucleic acid-binding proteins| OP:NHOMO 2231 OP:NHOMOORG 714 OP:PATTERN ------------------------------------------------------------------11 554-611222211112211-131122111112222244642223322-1222354212--442-4357751--111111-2121-122-----------1-214212524-----------------1-1-112-------------1-----------------------------------12122--2123666666666666676213333667211435233333365-33333333333332222234-113311-1-4311333212212341111111--------------1111111111111-111111113122212222222-1-1444211-3---2-11----241--42111112112--33341111143B55B444444533233333233-553754454941655465599797332223256545433333333332333333411111111----1111111111111111122232154445666566533324467444434557586512444111--------3212323231111111224233-4526----------666334653555561551-------------------1---1114433454348B433333332332333333411-121311122245445737557755-66-568555577557755765645444566555544544455555575545555319858987687991122-----3333243452211221-------23422423334333443354453534344522222222224448444442343333333333332222115-----------------1-------------------------23-1121212--- --11------------------1---------------------------1-----------------------------------------------------1---2------------------------------------------------------211-111---1----1521-223144-3422----1 ---------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------- STR:NPRED 67 STR:RPRED 100.0 SQ:SECSTR cEEEEEEEEETTTTEEEEEETTTEEEEEEEGGGccccccccccTTcEEEEEEEEETTEEEEEEEEEc PSIPRED ccccEEEEEEccccEEEEEccccccEEEEEEEEcccccccccccccEEEEEEEEcccccEEEEEEEc //