[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : cspC
DDBJ      :cspC         cold shock protein, DNA-binding
Swiss-Prot:             

Homologs  Archaea  10/68 : Bacteria  667/915 : Eukaryota  15/199 : Viruses  1/175   --->[See Alignment]
b.40.4
:67 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->67 1mef- PDBj 6e-16 53.7 %
:RPS:PDB   7->64 3camA PDBj 7e-17 56.9 %
:RPS:SCOP  6->67 1c9oA  b.40.4.5 * 2e-15 55.7 %
:HMM:SCOP  4->68 1h95A_ b.40.4.5 * 4.5e-22 58.5 %
:RPS:PFM   4->67 PF00313 * CSD 7e-16 59.4 %
:HMM:PFM   5->65 PF00313 * CSD 3e-28 60.7 61/67  
:BLT:SWISS 4->67 CSPC_SHIFL 2e-19 62.5 %
:PROS 18->37|PS00352|COLD_SHOCK

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30550.1 GT:GENE cspC GT:PRODUCT cold shock protein, DNA-binding GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(593809..594012) GB:FROM 593809 GB:TO 594012 GB:DIRECTION - GB:GENE cspC GB:PRODUCT cold shock protein, DNA-binding GB:PROTEIN_ID ACD30550.1 GB:DB_XREF GI:187712253 GB:GENE:GENE cspC LENGTH 67 SQ:AASEQ MNNKSQGTVKFFNEQKGFGFITPENGGKDVFVHISKLNGETLAEGQQVTFETQEGRKGPEAINIEVL GT:EXON 1|1-67:0| BL:SWS:NREP 1 BL:SWS:REP 4->67|CSPC_SHIFL|2e-19|62.5|64/69| PROS 18->37|PS00352|COLD_SHOCK|PDOC00304| BL:PDB:NREP 1 BL:PDB:REP 1->67|1mef-|6e-16|53.7|67/70| RP:PDB:NREP 1 RP:PDB:REP 7->64|3camA|7e-17|56.9|58/65| RP:PFM:NREP 1 RP:PFM:REP 4->67|PF00313|7e-16|59.4|64/67|CSD| HM:PFM:NREP 1 HM:PFM:REP 5->65|PF00313|3e-28|60.7|61/67|CSD| GO:PFM:NREP 2 GO:PFM GO:0003677|"GO:DNA binding"|PF00313|IPR002059| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00313|IPR002059| RP:SCP:NREP 1 RP:SCP:REP 6->67|1c9oA|2e-15|55.7|61/66|b.40.4.5| HM:SCP:REP 4->68|1h95A_|4.5e-22|58.5|65/0|b.40.4.5|1/1|Nucleic acid-binding proteins| OP:NHOMO 2173 OP:NHOMOORG 693 OP:PATTERN ------------------------31152123----------------------------------11 442-611222211112211-131122111112222254642223322-1222354212--442-4367761--11111----211122--------1--1-214212524-----------------1-1-112-------------1--------------------------------------22--2123666666666666676213333667211435233333365-33333333333332222234-112211-1-4311333211112341111111--------------1111111111111-11111111312221333323311-1444211-3---2-11--11241--42111112112--3224-111143944A344444533233333233-55375445374-4444435564962222232565454333333333323333333------------1111-1111111-----21132155555666566533324467444434557596512444111--------3212323231111111224233-4517----------666334653555561551-------------------1---1114433464248B433333332332333333411-121311122245445737557755-66-568555577557755765645444556555544544455555575545555319747876576881122-----666523345111-111-------13422423334343333555534444344423222232324448444443344433333333322222115-----------------1--------1--------1-------23-1121212--- --------------1-------1---------------------------1---------------------------------------------------------2------------------------------------------------------211------------------23143-111------ ---------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------- STR:NPRED 67 STR:RPRED 100.0 SQ:SECSTR TTccEEEEEEEEETTTTEEEEEETTccccEEEEGGGccGccccTTccEEEEEEEETTEEEEEEEEEc PSIPRED cccEEEEEEEEEEccccEEEEEEccccccEEEEEEEEcccccccccEEEEEEEEcccccEEEEEEEc //