[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : cutC
DDBJ      :cutC         copper homeostasis protein CutC family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  273/915 : Eukaryota  79/199 : Viruses  0/175   --->[See Alignment]
c.1.30
:240 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->203 1x7iB PDBj 6e-26 34.3 %
:RPS:PDB   4->203 2bdqA PDBj 5e-08 26.3 %
:RPS:SCOP  4->207 1twdA  c.1.30.1 * 2e-65 31.5 %
:HMM:SCOP  2->239 1twdA_ c.1.30.1 * 3.1e-60 39.3 %
:RPS:PFM   4->204 PF03932 * CutC 6e-46 44.7 %
:HMM:PFM   3->204 PF03932 * CutC 8.9e-64 42.5 200/202  
:BLT:SWISS 4->234 CUTC_HAEPS 2e-45 43.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31243.1 GT:GENE cutC GT:PRODUCT copper homeostasis protein CutC family protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1516268..1516990 GB:FROM 1516268 GB:TO 1516990 GB:DIRECTION + GB:GENE cutC GB:PRODUCT copper homeostasis protein CutC family protein GB:PROTEIN_ID ACD31243.1 GB:DB_XREF GI:187712946 GB:GENE:GENE cutC LENGTH 240 SQ:AASEQ MTNLEICVDNYQSIINAQKAGADRLELCSALGVEGLTPSPSLVKFAKENFTDSLQAMVRHRAGDFYYDEIDQQIMLDDLKAMLELDVNGIVIGALIRENKIDKNFLEPFIKLTKKAGKELTFHKAIDLTTDIYTATQEIIDLGFDRILTSGTATNVIVGLETIKSLQQQFGNQIQIMPGGGINSTNVKEILETTKVTSIHCSASKKILPDIDSLAFPVSALEIKVSQADEIIAIKSKLNN GT:EXON 1|1-240:0| BL:SWS:NREP 1 BL:SWS:REP 4->234|CUTC_HAEPS|2e-45|43.6|225/243| BL:PDB:NREP 1 BL:PDB:REP 1->203|1x7iB|6e-26|34.3|198/238| RP:PDB:NREP 1 RP:PDB:REP 4->203|2bdqA|5e-08|26.3|198/205| RP:PFM:NREP 1 RP:PFM:REP 4->204|PF03932|6e-46|44.7|199/202|CutC| HM:PFM:NREP 1 HM:PFM:REP 3->204|PF03932|8.9e-64|42.5|200/202|CutC| GO:PFM:NREP 2 GO:PFM GO:0005507|"GO:copper ion binding"|PF03932|IPR005627| GO:PFM GO:0055070|"GO:copper ion homeostasis"|PF03932|IPR005627| RP:SCP:NREP 1 RP:SCP:REP 4->207|1twdA|2e-65|31.5|200/234|c.1.30.1| HM:SCP:REP 2->239|1twdA_|3.1e-60|39.3|234/0|c.1.30.1|1/1|CutC-like| OP:NHOMO 378 OP:NHOMOORG 352 OP:PATTERN -------------------------------------------------------------------- 1------------------------------------11-----11------1-1--1--11----1-1-------------------1111-111---111--11-1--------------------------------------------------------------------------------------111111111111111------111----11122222211-------------------11-1-11--1--11--111-111-11111111111--111111111111111111111111111---1111----1-------1-1-1---1111--1-1-1-----------------111---11-----------------------------1----------1--111111111111--------------------------------------------------------------1---------------------11------1-1---------------------------1-------------------------------------------------------------------------11------1--1-------------------------------11111111--1111111-1111111111111111--1111111111111111111-1111-1111--111-111111111111-----------------------------1111-----------------------------111111111-1111111111111111111111111111---1---------1-1111----------1-1------1-------------------- ----1-1---------1--1---1-11---------------------------11-----------------------------------11111-----------121131112211111112112-261-21111111-11111111111111112---1211-1114111--1-------12---1-1------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 203 STR:RPRED 84.6 SQ:SECSTR ccEEEEEEETTTTGGGccTTTccEEEEEccGGGTcccccHHHHHHHHHHHHTTcEEEEcccccccccccHHHHHHHHHHHHHHHTTccEEEEccccTTccccHHHHHHHHHHHTTccEEEcGGGGccGTTTHHHHHHHHHHTTccEEEEccccccGGGGHHHHHHHHHHHTTcccEEEcccccTTTHHHHHHHHTccEEEETT##################################### PSIPRED ccEEEEEEccHHHHHHHHHccccEEEEEcccccccccccHHHHHHHHHHccccEEEEEEEccccccccHHHHHHHHHHHHHHHHccccEEEEEEEcccccccHHHHHHHHHHHHHccccEEEEcHHHHcccHHHHHHHHHHccccEEEcccccccHHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHcccEEEEccccccccccccccccccHHHHHcccHHHHHHHHHHHHc //