[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : cyoA
DDBJ      :cyoA         cytochrome bo terminal oxidase subunit II
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  437/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
b.6.1f.17.2
:300 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   28->278 1fftB PDBj 3e-69 50.0 %
:RPS:PDB   121->278 1cywA PDBj 7e-30 49.0 %
:RPS:SCOP  28->112 1fftB2  f.17.2.1 * 5e-25 50.6 %
:RPS:SCOP  121->278 1cywA  b.6.1.2 * 1e-30 49.0 %
:HMM:SCOP  24->113 1fftB2 f.17.2.1 * 6e-21 32.2 %
:HMM:SCOP  114->279 1fftB1 b.6.1.2 * 9e-51 32.1 %
:RPS:PFM   123->220 PF00116 * COX2 5e-05 25.5 %
:RPS:PFM   247->281 PF06481 * COX_ARM 6e-05 51.4 %
:HMM:PFM   238->281 PF06481 * COX_ARM 1.7e-17 41.9 43/47  
:HMM:PFM   144->220 PF00116 * COX2 3.1e-09 26.0 77/120  
:HMM:PFM   43->101 PF02790 * COX2_TM 7.8e-05 19.2 52/84  
:BLT:SWISS 26->277 QOX2_ACEAC 6e-69 50.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31390.1 GT:GENE cyoA GT:PRODUCT cytochrome bo terminal oxidase subunit II GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1679639..1680541) GB:FROM 1679639 GB:TO 1680541 GB:DIRECTION - GB:GENE cyoA GB:PRODUCT cytochrome bo terminal oxidase subunit II GB:PROTEIN_ID ACD31390.1 GB:DB_XREF GI:187713093 GB:GENE:GENE cyoA LENGTH 300 SQ:AASEQ MNWKKYLLILSSVVGVLSLSGCKGGIWNPMGVITAQEKQLLIFAIVLMLFVVVPVIILTLWFAWKYRDGANAEYRPTWSHSNKLEIICWGVPFIIILILAIVTWKTTHSLSPYKPLESDKKPVEIDVVALNWKWMFIYPEYDIATVNYIEIPKDRPINFKITSAAPMNSFFIPELAGQIYAMTGMTTQLHLIATHEGKYRGFSANYTGIGFAEMEFFAKVTDQADFDKWVKDVKNGKHQSLTWDYFWSDLFKDSIDNPVAYYSHVDKNLFNDIVMSYMMPNYKPGDMACNMSGMHMHHDM GT:EXON 1|1-300:0| BL:SWS:NREP 1 BL:SWS:REP 26->277|QOX2_ACEAC|6e-69|50.2|249/307| TM:NTM 3 TM:REGION 6->28| TM:REGION 41->62| TM:REGION 83->105| SEG 7->25|llilssvvgvlslsgckgg| BL:PDB:NREP 1 BL:PDB:REP 28->278|1fftB|3e-69|50.0|250/257| RP:PDB:NREP 1 RP:PDB:REP 121->278|1cywA|7e-30|49.0|157/159| RP:PFM:NREP 2 RP:PFM:REP 123->220|PF00116|5e-05|25.5|98/119|COX2| RP:PFM:REP 247->281|PF06481|6e-05|51.4|35/47|COX_ARM| HM:PFM:NREP 3 HM:PFM:REP 238->281|PF06481|1.7e-17|41.9|43/47|COX_ARM| HM:PFM:REP 144->220|PF00116|3.1e-09|26.0|77/120|COX2| HM:PFM:REP 43->101|PF02790|7.8e-05|19.2|52/84|COX2_TM| GO:PFM:NREP 7 GO:PFM GO:0004129|"GO:cytochrome-c oxidase activity"|PF00116|IPR002429| GO:PFM GO:0005507|"GO:copper ion binding"|PF00116|IPR002429| GO:PFM GO:0016020|"GO:membrane"|PF00116|IPR002429| GO:PFM GO:0008827|"GO:cytochrome o ubiquinol oxidase activity"|PF06481|IPR010514| GO:PFM GO:0016021|"GO:integral to membrane"|PF06481|IPR010514| GO:PFM GO:0022900|"GO:electron transport chain"|PF06481|IPR010514| GO:PFM GO:0055114|"GO:oxidation reduction"|PF06481|IPR010514| RP:SCP:NREP 2 RP:SCP:REP 28->112|1fftB2|5e-25|50.6|85/91|f.17.2.1| RP:SCP:REP 121->278|1cywA|1e-30|49.0|157/159|b.6.1.2| HM:SCP:REP 24->113|1fftB2|6e-21|32.2|90/91|f.17.2.1|1/1|Cytochrome c oxidase subunit II-like, transmembrane region| HM:SCP:REP 114->279|1fftB1|9e-51|32.1|165/166|b.6.1.2|1/1|Cupredoxins| OP:NHOMO 570 OP:NHOMOORG 445 OP:PATTERN ------------------------2--111-------------------------------1------ 1-311-----------------------------------1111------------1------1--1-----------------------------------------11--------------11-------------11----1-22-11-----2-11112--12111--------1--1---11---221222222222222222122211222122211111111132-1111111111111111111--------------------------------------------------------------------------------------------------1---------------------1-1-11111111--233-1--112111111111111-1122111321-12111211132321---11-11111-1-1111111112211-----1---------1----11--111-1-11----2-122122222223222222242222121332333--222-11111---2-21--1--1---------1121-1-----11-1-111---1-1111-221221---------------------------111113----221--111-11111221-121211-1--111111111111111111111111-1111111111111111111111111111111111111111111111----111111111111111111-11111121111-11---------------1111111---1122221211112111111-11111111-1--------21---22111111111111-1----1111-----------------------------------------------2- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 251 STR:RPRED 83.7 SQ:SECSTR ###########################ccccccHHHHHHHHHHHHHHTTTTTTHHHHHHHTTTTTTTcTTTcccccccccccHHHHHTTHHHHHHHHHHHHHHHHHHHTTcccEccccccccEEEEEEEETTEEEEEETTTTEEEEcEEEEETTcEEEEEEEEccccEEEEEGGGTEEEEEcTTccEEEEEEccccEEEEEcccccccTTTTTccEEEEEEcHHHHHHHHHHHHTcccccccHHHHHHHHHccccccccEEEccccTTHHHHHHGGGc###################### DISOP:02AL 300-301| PSIPRED ccHHHHHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHHHHHHHHcccHHHHHccHHHccccccccccccccccccEEEHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEEEEEEEEEEEEcccccccccEEEEccccEEEEEEEEccccHHHHHHHHcccEEEcccccEEEEEEEcccEEEEEEEEccccccccccEEEEEEEcHHHHHHHHHHHHccccccccHHHHHHHHHccccccccEEEEcccccHHHHHHHHHcccccccccHHHccccccccccc //