[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : cyoC
DDBJ      :cyoC         cytochrome bo terminal oxidase subunit III
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  469/915 : Eukaryota  10/199 : Viruses  0/175   --->[See Alignment]
f.25.1
:200 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   18->199 1fftC PDBj 4e-43 42.9 %
:RPS:SCOP  22->199 1fftC  f.25.1.1 * 1e-24 43.3 %
:HMM:SCOP  1->198 1m56C_ f.25.1.1 * 6.4e-50 33.3 %
:RPS:PFM   55->197 PF00510 * COX3 5e-08 28.6 %
:HMM:PFM   21->198 PF00510 * COX3 1.5e-19 30.3 175/258  
:BLT:SWISS 18->200 CYOC_PSEPU 6e-44 44.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31388.1 GT:GENE cyoC GT:PRODUCT cytochrome bo terminal oxidase subunit III GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1676971..1677573) GB:FROM 1676971 GB:TO 1677573 GB:DIRECTION - GB:GENE cyoC GB:PRODUCT cytochrome bo terminal oxidase subunit III GB:PROTEIN_ID ACD31388.1 GB:DB_XREF GI:187713091 GB:GENE:GENE cyoC LENGTH 200 SQ:AASEQ MSTVTAEHNHHHEHHFDGSKNVFGFWIYIMSDCVLFATLFATFAVFHKHTFGGPGAQELFSLPYVFVETMLLLISSFIFGLAMLNRNSENINHVIKFLWITFFLGLGFIIMEVHEFYELAIEGHTWSSSAFLSSFFTLVGTHGLHVSMGLIWIVSMIFQLKKYGMNPMAKTKLTYLGLFWHFLDIVWIFVFSIVYLLGAV GT:EXON 1|1-200:0| BL:SWS:NREP 1 BL:SWS:REP 18->200|CYOC_PSEPU|6e-44|44.3|183/207| TM:NTM 5 TM:REGION 25->47| TM:REGION 62->84| TM:REGION 92->114| TM:REGION 131->153| TM:REGION 177->199| SEG 7->15|ehnhhhehh| SEG 34->46|vlfatlfatfavf| SEG 127->136|sssaflssff| BL:PDB:NREP 1 BL:PDB:REP 18->199|1fftC|4e-43|42.9|182/185| RP:PFM:NREP 1 RP:PFM:REP 55->197|PF00510|5e-08|28.6|140/212|COX3| HM:PFM:NREP 1 HM:PFM:REP 21->198|PF00510|1.5e-19|30.3|175/258|COX3| GO:PFM:NREP 3 GO:PFM GO:0004129|"GO:cytochrome-c oxidase activity"|PF00510|IPR000298| GO:PFM GO:0006123|"GO:mitochondrial electron transport, cytochrome c to oxygen"|PF00510|IPR000298| GO:PFM GO:0016020|"GO:membrane"|PF00510|IPR000298| RP:SCP:NREP 1 RP:SCP:REP 22->199|1fftC|1e-24|43.3|178/185|f.25.1.1| HM:SCP:REP 1->198|1m56C_|6.4e-50|33.3|195/265|f.25.1.1|1/1|Cytochrome c oxidase subunit III-like| OP:NHOMO 600 OP:NHOMOORG 483 OP:PATTERN ------------------------211--1-------------------------------------- -1-----111111-11111-14111111111121121111--1111-1-11111-11-1111-1112-1------------------------------------1-1----------------11-------------11---1-111-111---------111--212-1-11111-11-1--------22222222222222222222222222212232111111113211111111111111111111--------------------------------------------------------------------------------------------------1---------------------1---11-11111--3221----11-11111111111-1121121213-12111122222221------1----12-1111111111111------1-111--11111111111111-1111-11-2-122221111111122211132222121213643--222-111111112-21--1211--------11-------------1------------------1----------------------------111112--1-22---111-2111111--21121------11-11111111111111111111-1111111111111111111111111111111111111111111111-111111111111111111111111111-1--12-11---------------1111111---1-11111212122221111-11111111-1--2-----111--22111111111111-------111-----------------------------------------------2- --------------------------------------------------------------------------------------------------------------------1-------2--------1------1--11--------1----------------4---1-------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 182 STR:RPRED 91.0 SQ:SECSTR #################TTHHHHHHHTTHHHHTTHHHHHHHHHTTTTTTccccccccccTTHHHHHHHHHHHGGGTTTTTcGGGTTTTccGGGGTHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccTTTHHHHHHHHHTTHHHHTTHHHHHHHHHHHHTcccTTcccHHHHHHHHHHHHHHHHHHHccccccccc# DISOP:02AL 200-201| PSIPRED ccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //