[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : cyoD
DDBJ      :cyoD         cytochrome bo terminal oxidase subunit IV
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:110 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   21->103 PF03626 * COX4_pro 1e-04 28.9 %
:HMM:PFM   21->103 PF03626 * COX4_pro 1.2e-27 53.0 83/83  
:BLT:SWISS 5->110 CYOD_SHIFL 6e-10 30.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31387.1 GT:GENE cyoD GT:PRODUCT cytochrome bo terminal oxidase subunit IV GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1676637..1676969) GB:FROM 1676637 GB:TO 1676969 GB:DIRECTION - GB:GENE cyoD GB:PRODUCT cytochrome bo terminal oxidase subunit IV GB:PROTEIN_ID ACD31387.1 GB:DB_XREF GI:187713090 GB:GENE:GENE cyoD LENGTH 110 SQ:AASEQ MAKEHLYDHDTGAAYGTHKSYIQGFVLSVVITTIAFVLVGFKLLSPVALCVTVAVLAVVQLFVQLVFFLHLSTDSKARWNLVSAIFAIIVVVIVVAGTMWIMFDLYDMMM GT:EXON 1|1-110:0| BL:SWS:NREP 1 BL:SWS:REP 5->110|CYOD_SHIFL|6e-10|30.5|105/109| TM:NTM 3 TM:REGION 21->43| TM:REGION 50->72| TM:REGION 83->105| SEG 47->69|valcvtvavlavvqlfvqlvffl| SEG 82->96|vsaifaiivvvivva| RP:PFM:NREP 1 RP:PFM:REP 21->103|PF03626|1e-04|28.9|83/83|COX4_pro| HM:PFM:NREP 1 HM:PFM:REP 21->103|PF03626|1.2e-27|53.0|83/83|COX4_pro| GO:PFM:NREP 1 GO:PFM GO:0016021|"GO:integral to membrane"|PF03626|IPR005171| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 82-99,101-101| PSIPRED cccccccHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //