[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : cysK
DDBJ      :cysK         cysteine synthase
Swiss-Prot:             

Homologs  Archaea  38/68 : Bacteria  799/915 : Eukaryota  182/199 : Viruses  0/175   --->[See Alignment]
c.79.1
:307 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->305 1m54A PDBj 2e-25 30.1 %
:RPS:PDB   4->305 3bm5B PDBj 1e-40 24.0 %
:RPS:SCOP  4->305 1d6sA  c.79.1.1 * 2e-63 28.8 %
:HMM:SCOP  1->302 1fcjA_ c.79.1.1 * 2.8e-66 30.6 %
:RPS:PFM   4->282 PF00291 * PALP 1e-15 32.2 %
:HMM:PFM   4->297 PF00291 * PALP 1.3e-60 29.0 276/297  
:BLT:SWISS 4->305 CYSM_CAMJE 3e-28 37.6 %
:PROS 25->43|PS00901|CYS_SYNTHASE
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30982.1 GT:GENE cysK GT:PRODUCT cysteine synthase GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1153916..1154839 GB:FROM 1153916 GB:TO 1154839 GB:DIRECTION + GB:GENE cysK GB:PRODUCT cysteine synthase GB:PROTEIN_ID ACD30982.1 GB:DB_XREF GI:187712685 GB:GENE:GENE cysK LENGTH 307 SQ:AASEQ MLSLIGKTPIIKLKNTINNHNLYAKCEWLNPTGSIKDRVAKYILENLIKNKKIKPQQAIIEASSGNMGTSLAAIGKLYKHPVYITCPEKTGQIKREMIKSFGANLTICKNTSDHTDPDFYVNKAKQLTEDLDGILVNQYDNLLNTECHYKTTGQEIVDYFLTQNVDIDYFITVGGSGGTITGCAKKIKEFFPKTQVIMPDPYGSVYYDIFYHGAPIKENIHSYKVEGPGNPVFCKSMDLAYIDEIIQFSDNQAIQACHELASEQGIYAGHSSGANYFIAKKLLEKLPQHQSYNILIMVLDSGMKYAF GT:EXON 1|1-307:0| BL:SWS:NREP 1 BL:SWS:REP 4->305|CYSM_CAMJE|3e-28|37.6|282/299| PROS 25->43|PS00901|CYS_SYNTHASE|PDOC00700| SEG 41->54|kyilenliknkkik| SEG 171->182|itvggsggtitg| BL:PDB:NREP 1 BL:PDB:REP 1->305|1m54A|2e-25|30.1|286/352| RP:PDB:NREP 1 RP:PDB:REP 4->305|3bm5B|1e-40|24.0|287/335| RP:PFM:NREP 1 RP:PFM:REP 4->282|PF00291|1e-15|32.2|261/293|PALP| HM:PFM:NREP 1 HM:PFM:REP 4->297|PF00291|1.3e-60|29.0|276/297|PALP| GO:PFM:NREP 3 GO:PFM GO:0003824|"GO:catalytic activity"|PF00291|IPR001926| GO:PFM GO:0008152|"GO:metabolic process"|PF00291|IPR001926| GO:PFM GO:0030170|"GO:pyridoxal phosphate binding"|PF00291|IPR001926| RP:SCP:NREP 1 RP:SCP:REP 4->305|1d6sA|2e-63|28.8|292/323|c.79.1.1| HM:SCP:REP 1->302|1fcjA_|2.8e-66|30.6|291/302|c.79.1.1|1/1|Tryptophan synthase beta subunit-like PLP-dependent enzymes| OP:NHOMO 2252 OP:NHOMOORG 1019 OP:PATTERN --1121--111111111-------2221123211--------132-1--111---1---121111--1 4232221222222122233-32223233232332223233133212112221333122--423122442421111-11-2114111112221-1-----32423321133---------------2212232332222222111313224224222422222222225542222222222222211111111333333333333333433233333333331322111111552333333333333322222222-21122-2-112212-2--1122211111111111111111111111111111111111112221111243233333333332222212222121-12221113222131232211213113223-----222222223432311112111111122222322142-4222224222222223321122222122222222221122323-----------------------------1222221111122212221111111211121121234331211322222233222112112232111111112222332211221122111-232232342554548222111111111112111111121111112211221221112222212222212222211--22211--11133422332222222222-2222222222222222222343336532222222222222222422222222-33332332333311-311111111122332111---111-1111122222221112243333233222222533211111111111112222211111222222222222221121333322------------------------------------1111111111122 ----234-421-2243333333334332222333322545245212334633643233333333333323223332212233333322-14232222222222444-4D22122421111222195-416H2-31312--2-2211211-31-2-111-13323222222168343444r4445559DE2F53397667 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 306 STR:RPRED 99.7 SQ:SECSTR HHHGcccccEEEccGccTTcEEEEEEGGGcTTccTHHHHHHHHHHHHHHHTcccTTcEEEEEcccHHHHHHHHHHHHHTccEEEEEETTccHHHHHHHTTTTccccEEcTTcccTTHHHTHHHHHHHHHcGGGEEEccTTTcHHHHHHHHHHHHHHHHHTccETTcEEEEEEEccccHHHHHHHHHHHTTcTTcEEEEEEEGGGcTTTTcccccccccccGGcccTTcccccccTTccGGGccEEEEEcHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHTccGGGTTcEEEEEEcccGGGGH# PSIPRED cccccccccEEEccccccccEEEEEEccccccccHHHHHHHHHHHHHHHccccccccEEEEccccHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHHHHcccEEEcccccHHHHHHHHHHHHHHHHHHHHHccccccEEEEEccccHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHccccccccccccEEEcccccHHHHHHHHHHccEEEEEcHHHHHHHHHHHHHHcccEEccHHHHHHHHHHHHHHHcccccccEEEEEEccccccccc //