[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : deoD
DDBJ      :deoD         purine nucleoside phosphorylase
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  339/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.56.2
:240 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   5->237 1vhwE PDBj 8e-34 35.9 %
:RPS:PDB   7->238 3ddoC PDBj 1e-31 15.6 %
:RPS:SCOP  5->237 1a69A  c.56.2.1 * 3e-52 32.5 %
:HMM:SCOP  4->242 1ecpA_ c.56.2.1 * 6.8e-73 40.5 %
:RPS:PFM   21->221 PF01048 * PNP_UDP_1 7e-04 25.6 %
:HMM:PFM   18->224 PF01048 * PNP_UDP_1 6e-42 28.6 206/234  
:BLT:SWISS 17->237 DEOD_CLOB8 1e-39 40.0 %
:PROS 65->80|PS01232|PNP_UDP_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31166.1 GT:GENE deoD GT:PRODUCT purine nucleoside phosphorylase GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1414127..1414849) GB:FROM 1414127 GB:TO 1414849 GB:DIRECTION - GB:GENE deoD GB:PRODUCT purine nucleoside phosphorylase GB:PROTEIN_ID ACD31166.1 GB:DB_XREF GI:187712869 GB:GENE:GENE deoD LENGTH 240 SQ:AASEQ MLLPTPHIETLRKEEFAKTVIMPGDPLRAKYIADNYLENVVRVNAVRNMFGYTGTYKGKKVSVMGSGMGMPSMGIYAYELFKYYDVDNIIRVGSAGSYKAEFKVYDVVLIEESYCESNFIEIVTGSKTSDVRSSEELNKELIASAQRQDIELKKAKAHCTDVFYRKNSDDYKKIVKKYNCDLVEMETAALFATAAELGKKASAVVTISDSFITGESTTAQQREQSFTNMMEVALGTIKEN GT:EXON 1|1-240:0| BL:SWS:NREP 1 BL:SWS:REP 17->237|DEOD_CLOB8|1e-39|40.0|220/237| PROS 65->80|PS01232|PNP_UDP_1|PDOC00946| SEG 57->74|kgkkvsvmgsgmgmpsmg| SEG 186->197|etaalfataael| BL:PDB:NREP 1 BL:PDB:REP 5->237|1vhwE|8e-34|35.9|231/236| RP:PDB:NREP 1 RP:PDB:REP 7->238|3ddoC|1e-31|15.6|225/249| RP:PFM:NREP 1 RP:PFM:REP 21->221|PF01048|7e-04|25.6|199/229|PNP_UDP_1| HM:PFM:NREP 1 HM:PFM:REP 18->224|PF01048|6e-42|28.6|206/234|PNP_UDP_1| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF01048|IPR000845| GO:PFM GO:0009116|"GO:nucleoside metabolic process"|PF01048|IPR000845| RP:SCP:NREP 1 RP:SCP:REP 5->237|1a69A|3e-52|32.5|231/237|c.56.2.1| HM:SCP:REP 4->242|1ecpA_|6.8e-73|40.5|237/0|c.56.2.1|1/1|Purine and uridine phosphorylases| OP:NHOMO 397 OP:NHOMOORG 342 OP:PATTERN ---1---1------------------------------------------------------------ ------1-----1----------------------------------1-------1----111---------------1---1----------------1---1-------------------------------------------------------------------------------111-----1111111111111111111-111111111111111111111-122222222222222111111-1-11-------11111-----1111111---1111111111111111111111111111111111111-1--2-------2-21---111111111-1-------------111--11----------------------------------------------1-------------------11-----111-----------------------------------------------------------------------------------------------------------1------------------------------------------1--------------1-1111111-------221---11-111112111321121333253--1----11-11111111111111111111-111111111111111111111111111111111111111111111111111--111111111111---------------11-111111111111111-----------------------------111111111-13322222222222-----------------1--------------111----1-2111311111111111111------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 240 STR:RPRED 100.0 SQ:SECSTR HHHHccccccccHHHHccEEEEEccTHHHHHHHHTTcEEEEEEEEETTEEEEEEEETTEEEEEEcccccHHHHHHHHHHHHHTTTccEEEEEEEEccccTTccTTcEEEEEEEEEEEccGGGGTccTTccEEccHHHHHHHHHHHHHTTccEEEEEEEEEccccGGGTcccccccGGGTTHHEEccHHHHHHHHHTTTcEEEEEEEEEEEcccTTTccHHHHHHHHHHHHHHHHHHHHHH PSIPRED ccccccccccccccccccEEEEcccHHHHHHHHHHHccccEEEEEcccEEEEEEEEccEEEEEEEccccHHHHHHHHHHHHHHccccEEEEEEEEcccccccccccEEEEEEEEccccccccccccccccccccHHHHHHHHHHHHHccccEEEEEEEEccccccccHHHHHHHHHHccccEEEccHHHHHHHHHHccccEEEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHcc //