[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : dnaJ
DDBJ      :dnaJ         chaperone protein DnaJ
Swiss-Prot:DNAJ_FRATT   RecName: Full=Chaperone protein dnaJ;

Homologs  Archaea  26/68 : Bacteria  910/915 : Eukaryota  197/199 : Viruses  2/175   --->[See Alignment]
a.2.3b.4.1g.54.1
:395 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   27->91 2dmxA PDBj 4e-19 63.1 %
:BLT:PDB   151->223 1exkA PDBj 4e-21 53.4 %
:BLT:PDB   235->362 2q2gB PDBj 6e-10 33.1 %
:RPS:PDB   24->97 1bq0A PDBj 5e-23 66.2 %
:RPS:PDB   149->392 1cmwA PDBj 1e-48 11.5 %
:RPS:SCOP  24->97 1bq0A  a.2.3.1 * 2e-23 66.2 %
:RPS:SCOP  151->223 1exkA  g.54.1.1 * 8e-16 50.7 %
:RPS:SCOP  199->273 1nltA1  b.4.1.1 * 1e-11 14.7 %
:RPS:SCOP  275->361 1c3gA2  b.4.1.1 * 7e-28 28.7 %
:HMM:SCOP  10->99 1iurA_ a.2.3.1 * 1.5e-30 54.5 %
:HMM:SCOP  135->273 1c3gA1 b.4.1.1 * 9.7e-25 48.8 %
:HMM:SCOP  274->361 1c3gA2 b.4.1.1 * 1.5e-21 48.9 %
:RPS:PFM   27->87 PF00226 * DnaJ 1e-19 68.9 %
:RPS:PFM   151->223 PF00684 * DnaJ_CXXCXGXG 2e-18 53.4 %
:RPS:PFM   261->353 PF01556 * DnaJ_C 2e-21 51.6 %
:HMM:PFM   132->159 PF01556 * DnaJ_C 0.00033 35.7 28/101  
:HMM:PFM   228->270 PF01556 * DnaJ_C 5.3e-08 37.2 43/101  
:HMM:PFM   261->359 PF01556 * DnaJ_C 5.5e-32 47.5 99/101  
:HMM:PFM   27->88 PF00226 * DnaJ 1.4e-30 69.4 62/64  
:HMM:PFM   151->223 PF00684 * DnaJ_CXXCXGXG 2.6e-19 39.7 73/79  
:BLT:SWISS 22->395 DNAJ_FRATT 0.0 100.0 %
:PROS 68->87|PS00636|DNAJ_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30965.1 GT:GENE dnaJ GT:PRODUCT chaperone protein DnaJ GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1138003..1139190) GB:FROM 1138003 GB:TO 1139190 GB:DIRECTION - GB:GENE dnaJ GB:PRODUCT chaperone protein DnaJ GB:PROTEIN_ID ACD30965.1 GB:DB_XREF GI:187712668 GB:GENE:GENE dnaJ LENGTH 395 SQ:AASEQ MVYPHFSFCYNGLSKIFRLSKMQQKCYYEILNVSKTASGVEIKRAYRKLAMEYHPDRNPGDKEAEIKFKEISEAYEILSDDSKRSRYDQFGHAGVNQQSGFGGTGGFGGFEDIFDTFFGGGTSRGSNRSRASRGSDLEYTLEITLEEAFFGVEKEITIPRMESCDSCDGTGSKSRSKTTCHACHGQGTIRRQQGFFAFEQTCPVCNGTGYSITDPCDACYGNGKVKKQKTLKVKIPEGVDNGDRIRLQGEGDSGSNGAMNGDLYVQIIIKEHKIFERRDINLYCEMPISFTKACLGGDIKVPTLDGEVVLKVVPETQTGKVFRLREKGMKSLRGHRRGDLLCKVVVETPVNLSAEQKELLEKFADSLGEDYQSKHAPKSKTWFDNVKDYAKKFFE GT:EXON 1|1-395:0| SW:ID DNAJ_FRATT SW:DE RecName: Full=Chaperone protein dnaJ; SW:GN Name=dnaJ; OrderedLocusNames=FTT1268c; SW:KW Chaperone; Complete proteome; Cytoplasm; DNA replication;Metal-binding; Repeat; Stress response; Zinc; Zinc-finger. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 22->395|DNAJ_FRATT|0.0|100.0|374/374| GO:SWS:NREP 4 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0006260|"GO:DNA replication"|DNA replication| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0006950|"GO:response to stress"|Stress response| PROS 68->87|PS00636|DNAJ_1|PDOC00553| SEG 100->135|gfggtggfggfedifdtffgggtsrgsnrsrasrgs| SEG 224->234|kvkkqktlkvk| BL:PDB:NREP 3 BL:PDB:REP 27->91|2dmxA|4e-19|63.1|65/92| BL:PDB:REP 151->223|1exkA|4e-21|53.4|73/79| BL:PDB:REP 235->362|2q2gB|6e-10|33.1|124/159| RP:PDB:NREP 2 RP:PDB:REP 24->97|1bq0A|5e-23|66.2|74/77| RP:PDB:REP 149->392|1cmwA|1e-48|11.5|218/817| RP:PFM:NREP 3 RP:PFM:REP 27->87|PF00226|1e-19|68.9|61/63|DnaJ| RP:PFM:REP 151->223|PF00684|2e-18|53.4|73/78|DnaJ_CXXCXGXG| RP:PFM:REP 261->353|PF01556|2e-21|51.6|93/95|DnaJ_C| HM:PFM:NREP 5 HM:PFM:REP 132->159|PF01556|0.00033|35.7|28/101|DnaJ_C| HM:PFM:REP 228->270|PF01556|5.3e-08|37.2|43/101|DnaJ_C| HM:PFM:REP 261->359|PF01556|5.5e-32|47.5|99/101|DnaJ_C| HM:PFM:REP 27->88|PF00226|1.4e-30|69.4|62/64|DnaJ| HM:PFM:REP 151->223|PF00684|2.6e-19|39.7|73/79|DnaJ_CXXCXGXG| GO:PFM:NREP 6 GO:PFM GO:0031072|"GO:heat shock protein binding"|PF00226|IPR001623| GO:PFM GO:0006457|"GO:protein folding"|PF00684|IPR001305| GO:PFM GO:0031072|"GO:heat shock protein binding"|PF00684|IPR001305| GO:PFM GO:0051082|"GO:unfolded protein binding"|PF00684|IPR001305| GO:PFM GO:0006457|"GO:protein folding"|PF01556|IPR002939| GO:PFM GO:0051082|"GO:unfolded protein binding"|PF01556|IPR002939| RP:SCP:NREP 4 RP:SCP:REP 24->97|1bq0A|2e-23|66.2|74/77|a.2.3.1| RP:SCP:REP 151->223|1exkA|8e-16|50.7|73/79|g.54.1.1| RP:SCP:REP 199->273|1nltA1|1e-11|14.7|67/74|b.4.1.1| RP:SCP:REP 275->361|1c3gA2|7e-28|28.7|87/90|b.4.1.1| HM:SCP:REP 10->99|1iurA_|1.5e-30|54.5|88/88|a.2.3.1|1/1|Chaperone J-domain| HM:SCP:REP 135->273|1c3gA1|9.7e-25|48.8|80/80|b.4.1.1|1/2|HSP40/DnaJ peptide-binding domain| HM:SCP:REP 274->361|1c3gA2|1.5e-21|48.9|88/90|b.4.1.1|2/2|HSP40/DnaJ peptide-binding domain| OP:NHOMO 5559 OP:NHOMOORG 1135 OP:PATTERN ------------------------11111211111--------2212211111--------111--22 2222322222222222222-22222222222222222253233322222222222232222222222322222222223222222222222212111112321323323211111111111111111111111121333332222243533356434222322434344541213111213312212211211111111111111111111111111111121221111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111121111221111211221131222212212111112113222222422221233232222222222222222222124223232222142222232232322222112111111122222222222222331111111111111111111111111111112233222222211112111111133111111113232222221311222224213343111112222222222324233232222322222222323222222233552212222222222222222222222221111212122311111122111111111111-1221211111121111112222222222-22222222222222222222221111222222222222222222222222211211111111111111122222322322222111121111-11111222221222221111122221222213332222222222222111111111112222222222222211221111112221221121111111-11111521111112111111111111111221 RECEHHG-*KM4JNJBECEDFFEFBBFDC9BCCBECFFDE9FDCCDCDCDCCEDCACAADBDBDEBCB5ACBCBDBB7BACCABCBDF-DIEEGDBB87DAAEPJL1En8ciobZcNIHEGIUFjaEaF**X1cVdFI9EgCLbOEHJJCQHFgGNLSNEJJIJGGDhMMbHGRCCQIP*EEBJIechxEnVMQRNQNT --------------------------------------------------------------------------------------------------------------------------------------------------------------------------2--1- STR:NPRED 377 STR:RPRED 95.4 SQ:SECSTR ##########ccccccccccccccccHHHHHTccTTccHHHHHHHHHHHHHHTcTTTccccTTHHHHHHHHHHHHHHHHcHHHHHHHHHcccccccccTHHHHHHHcTTcccEEEEEcTTccEEEccccccccHHcccccccccccccccccccccccccccHHHHTTTTTTTTTTTcHHHHHHHHHHHHHHHHHHTccTTTcccTTTcccccEEEcccccccccEEEcccGGGccTTcHHHHHHHHTccccTTEEEEEEEETTHHHHHHHHHHTcHHHHHHHHHTccHHHHHHHHHTccGGGccHHEEEEEcccccTTcEHHHHHHHHHHHTTccccHHHHHHHccccHHHHHHHHHHHHHHHHH#####TTHHcHHHHHHHHHHHHHHHH### DISOP:02AL 395-396| PSIPRED cccccccccHHHHHHHHHccccccccHHHHHcccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHcccccccccccccccccccccHHHHHHHccccccccccccccccccccEEEEEEEEcccEEccEEEEEEEccccccccccccccccccccccccccccccEEEEEEEEEEEEEEcccccccEEEEEEccccccccEEEEEEEEEEEcccccccccEEEEcccccccccccccccEEEEEEEEccccEEEEccEEEEEEEccHHHHccccEEEEEcccccEEEEcccccccccEEEEcccccccccccccccEEEEEEEEccccccHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHcc //