[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : dnaK
DDBJ      :dnaK         chaperone, heat shock protein, HSP 70 family
Swiss-Prot:DNAK_FRATM   RecName: Full=Chaperone protein dnaK;AltName: Full=Heat shock protein 70;AltName: Full=Heat shock 70 kDa protein;AltName: Full=HSP70;

Homologs  Archaea  27/68 : Bacteria  912/915 : Eukaryota  197/199 : Viruses  1/175   --->[See Alignment]
a.8.4b.130.1c.55.1c.78.2e.39.1
:642 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   4->595 2khoA PDBj 0.0 74.6 %
:RPS:PDB   2->545 3c7nB PDBj e-132 54.1 %
:RPS:SCOP  1->48 1t6cA1  c.55.1.8 * 4e-04 22.9 %
:RPS:SCOP  80->329 1mw7A  e.39.1.1 * 6e-45 15.3 %
:RPS:SCOP  324->409 1b73A2  c.78.2.1 * 5e-12 19.0 %
:RPS:SCOP  390->542 3c7nB1  b.130.1.1 * 7e-60 65.4 %
:HMM:SCOP  1->186 1hjoA1 c.55.1.1 * 3.3e-63 58.2 %
:HMM:SCOP  188->387 1dkgD2 c.55.1.1 * 1.1e-67 53.0 %
:HMM:SCOP  385->542 1ckrA_ b.130.1.1 * 6.8e-62 66.5 %
:HMM:SCOP  509->605 1dkzA1 a.8.4.1 * 3.4e-23 39.2 %
:RPS:PFM   6->499 PF00012 * HSP70 e-153 67.9 %
:HMM:PFM   4->605 PF00012 * HSP70 3.5e-267 65.9 595/602  
:BLT:SWISS 1->600 DNAK_FRATM 0.0 100.0 %
:PROS 7->14|PS00297|HSP70_1
:PROS 194->207|PS00329|HSP70_2
:PROS 339->353|PS01036|HSP70_3
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30966.1 GT:GENE dnaK GT:PRODUCT chaperone, heat shock protein, HSP 70 family GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1139216..1141144) GB:FROM 1139216 GB:TO 1141144 GB:DIRECTION - GB:GENE dnaK GB:PRODUCT chaperone, heat shock protein, HSP 70 family GB:PROTEIN_ID ACD30966.1 GB:DB_XREF GI:187712669 GB:GENE:GENE dnaK LENGTH 642 SQ:AASEQ MGKIIGIDLGTTNSCLAIMDGKTAKVIENAEGHRTTPSVVAYTDSGEILVGQAAKRQAVTNPDNTFFAIKRLIGRKYDDKAVQEDIKKKVPYAVIKADNGDAWVATKEGKKMAPPQVSAEVLRKMKKTAEDYLGEPVTEAVITVPAYFNDSQRQATKDAGKIAGLEVKRIINEPTAAALAYGVDSKKGEQTVAVYDLGGGTFDISIIEIADVDGDNQIEVLSTNGDTFLGGEDFDLALMNYLIDEFKKEQGIDLHNDKLALQRVREAAEKAKVELSSAQQTDVNLPYITADATGPKHLNIKVTRAKFESLVSDLVMRSLEPCKKALEDAGLSKSDITEVLLVGGQTRMPLVQEKVKEFFGKEPRKDMNPDEAVAVGAAIQGGVLAGDVKDVLLLDVTPLSLGIETMGGVMTKLIERNTTIPTKKSQVFSTAEDNQPAVTIHVLQGEREMASANKSLGRFDLADIPPAPRGMPQIEVTFDIDANGILNVSAKDKATGKEQNIVIKSSSGLSEEDIEKMVQDAEANAEADKKFHDLVTARNTADNLIHSSRKAIQELGEKVTAAEKEKIEEACKELEAATKGDDKQAIEAKTKALEEAFAPIAQKAYAEQAQAAGAQGGAKAEEPKKEEDVVDADFEDVEDDKK GT:EXON 1|1-642:0| SW:ID DNAK_FRATM SW:DE RecName: Full=Chaperone protein dnaK;AltName: Full=Heat shock protein 70;AltName: Full=Heat shock 70 kDa protein;AltName: Full=HSP70; SW:GN Name=dnaK; OrderedLocusNames=FTM_1061; SW:KW ATP-binding; Chaperone; Complete proteome; Nucleotide-binding;Phosphoprotein; Stress response. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->600|DNAK_FRATM|0.0|100.0|600/642| GO:SWS:NREP 3 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006950|"GO:response to stress"|Stress response| PROS 7->14|PS00297|HSP70_1|PDOC00269| PROS 194->207|PS00329|HSP70_2|PDOC00269| PROS 339->353|PS01036|HSP70_3|PDOC00269| COIL:NAA 24 COIL:NSEG 1 COIL:REGION 257->280| SEG 372->386|avavgaaiqggvlag| SEG 557->577|ekvtaaekekieeackeleaa| SEG 601->641|aqkayaeqaqaagaqggakaeepkkeedvvdadfedveddk| BL:PDB:NREP 1 BL:PDB:REP 4->595|2khoA|0.0|74.6|590/600| RP:PDB:NREP 1 RP:PDB:REP 2->545|3c7nB|e-132|54.1|534/540| RP:PFM:NREP 1 RP:PFM:REP 6->499|PF00012|e-153|67.9|480/488|HSP70| HM:PFM:NREP 1 HM:PFM:REP 4->605|PF00012|3.5e-267|65.9|595/602|HSP70| RP:SCP:NREP 4 RP:SCP:REP 1->48|1t6cA1|4e-04|22.9|48/126|c.55.1.8| RP:SCP:REP 80->329|1mw7A|6e-45|15.3|216/220|e.39.1.1| RP:SCP:REP 324->409|1b73A2|5e-12|19.0|84/147|c.78.2.1| RP:SCP:REP 390->542|3c7nB1|7e-60|65.4|153/154|b.130.1.1| HM:SCP:REP 1->186|1hjoA1|3.3e-63|58.2|184/0|c.55.1.1|1/1|Actin-like ATPase domain| HM:SCP:REP 188->387|1dkgD2|1.1e-67|53.0|198/0|c.55.1.1|1/1|Actin-like ATPase domain| HM:SCP:REP 385->542|1ckrA_|6.8e-62|66.5|158/159|b.130.1.1|1/1|Heat shock protein 70kD (HSP70), peptide-binding domain| HM:SCP:REP 509->605|1dkzA1|3.4e-23|39.2|97/97|a.8.4.1|1/1|Heat shock protein 70kD (HSP70), C-terminal subdomain| OP:NHOMO 4177 OP:NHOMOORG 1137 OP:PATTERN ------------------------11121111111-------12211211212--------111--11 2241211222221112211-11112211111211112273164911111111321121112211238212111111111121111111221111111111111111112311111111111111331122111222223221112144554443344222322444254542222222222221111111121122222122121111121111112211111221111122211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111122232222211221112AA32221111112211112214111121111141131113111111111211111111111111111111111122111111211211211111221111111111111111111111111121122222222222222122222222222222112121322223333332222233422222223463433223343232254332233422223222322221113331332111111211112112113129989D612111111111111111111111111122232111312222222222222222222223111212222222224222213333323232-33433223223233333332222322232323233333232222332223311222222222222111211111111131314222222222222222222321322222222233432222223331111111111443422222332333111111111111122211111112222222211111111-11111111111111111111111111111112 5555D791UDC466877966777777777577777777785777778777777979787777A9999969BCB8CLE8GE99999998-7B778799987696BCI38MQEIMNKKEBBAF9BANHBP8**G1IHU9AA8LCCEBACB8AC88QBEBCEBFO9OFABR8-C9DA969C8*787B9OUac7LH9BJIJL9 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------2---- STR:NPRED 600 STR:RPRED 93.5 SQ:SECSTR ccccEEEEccccEEEEEEEccccEEEcccTTccccEEccEEEETcTEEEETHHHHHcTTccTTTEEccGGGGTTccTTcHHHHHHTTTcccEEEEccccEEEEEcTTccEEEcHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcTTccHHHHHHHHHHHHHTTcEEEEEEEHHHHHHHHTTGGGccccEEEEEEEEccccEEEEEEEEHHHEETTEEEEEEEEEETTccTHHHHHHHHHHHHHHHHHHHccccTTcTTHHHHHHHHHHHHHHHTTTccEEEEEEEEEETTccccEEEEEEEEHHHHHHHTHHHHHTTHHHHHHHHHHTTccGGGccEEEEEcGGGGcHHHHHHHHHTTTccEEccccGGGHHHHHHHHHHHHTTTTcccccccccccccEEEEETTTEEEEEEcTTccccEEEEEEEccccTTccEEEEEEEEcccccTTccEEEEEEEEEccccccTTcccEEEEEEEcTTccEEEEEEcTTTccEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHTTTGGGccHHHHHHHHHHHHHHHHHTTTcHHHHHHHHHHHHHHHHHH########################################## PSIPRED cccEEEEEEccccEEEEEEEcccEEEEEcccccccccEEEEEcccccEEEcHHHHHHHHHccccEEEEEHHHcccccccHHHHHHHHHccccEEEEcccccEEEEEccccEEEHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHHHcccccEEEEEcccHHHHHHccccccccccEEEEEEcccccEEEEEEEEEEcccccEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHccccccEEEEEEEEccccccEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHccEEEEEcccccHHHHHHHHHHHcccccccccccccEEEEEcHHEEEEcccccccEEEEEEEEEEEEEEEEccEEEEEEcccccccccEEEEEEcccccccEEEEEEEEccccccccccEEEEEEEcccccccccEEEEEEEEEEccccEEEEEEEEccccEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccEEEcccccc //