[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : feoA
DDBJ      :feoA         Fe2+ transport system protein A
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.34.1
:74 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->73 2gcxA PDBj 2e-08 28.8 %
:RPS:PDB   5->73 3e19C PDBj 2e-08 22.7 %
:RPS:SCOP  1->73 2gcxA1  b.34.1.2 * 7e-19 28.8 %
:HMM:PFM   7->63 PF04023 * FeoA 4.2e-08 16.1 56/74  
:BLT:SWISS 1->74 FEOA_ECOLI 2e-08 31.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30608.1 GT:GENE feoA GT:PRODUCT Fe2+ transport system protein A GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 677903..678127 GB:FROM 677903 GB:TO 678127 GB:DIRECTION + GB:GENE feoA GB:PRODUCT Fe2+ transport system protein A GB:PROTEIN_ID ACD30608.1 GB:DB_XREF GI:187712311 GB:GENE:GENE feoA LENGTH 74 SQ:AASEQ MTYNKNDKFIVRGFHTNCPAAFKDKIIAMGVIEGQQMTVTNKSILGGPIAFETNCGAFSLRKKDLEFLKLEKIN GT:EXON 1|1-74:0| BL:SWS:NREP 1 BL:SWS:REP 1->74|FEOA_ECOLI|2e-08|31.1|74/75| BL:PDB:NREP 1 BL:PDB:REP 1->73|2gcxA|2e-08|28.8|73/75| RP:PDB:NREP 1 RP:PDB:REP 5->73|3e19C|2e-08|22.7|66/77| HM:PFM:NREP 1 HM:PFM:REP 7->63|PF04023|4.2e-08|16.1|56/74|FeoA| RP:SCP:NREP 1 RP:SCP:REP 1->73|2gcxA1|7e-19|28.8|73/75|b.34.1.2| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 73 STR:RPRED 98.6 SQ:SECSTR cGccTTcEEEEEEEccHHcHHHHHHHHTTTccTTcEEEEEEcccTTccEEEEETTEEEEEcHHHHTTEEEEEc# DISOP:02AL 74-75| PSIPRED cEEccccEEEEEEEcccccHHHHHHHHHHccccccEEEEEEEccccccEEEEEccEEEEEEHHHHccEEEEEEc //