[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ffh
DDBJ      :ffh          signal recognition particle GTPase
Swiss-Prot:             

Homologs  Archaea  67/68 : Bacteria  902/915 : Eukaryota  194/199 : Viruses  0/175   --->[See Alignment]
a.24.13a.36.1b.106.1c.37.1
:458 amino acids
:PSIPRED
:BLT:PDB   2->427 2j289 PDBj e-154 62.4 %
:RPS:PDB   1->435 3dm5A PDBj 1e-51 36.1 %
:RPS:SCOP  22->198 1wruA2  b.106.1.1 * 1e-34 11.8 %
:RPS:SCOP  298->427 1qzwA2  a.36.1.1 * 3e-35 28.5 %
:HMM:SCOP  1->94 1wgwA_ a.24.13.1 * 2.1e-25 50.0 %
:HMM:SCOP  92->298 1ls1A2 c.37.1.10 * 9.8e-53 35.4 %
:HMM:SCOP  298->428 1qzxA2 a.36.1.1 * 3.5e-42 50.4 %
:RPS:PFM   9->82 PF02881 * SRP54_N 5e-06 40.0 %
:RPS:PFM   100->295 PF00448 * SRP54 2e-51 53.3 %
:RPS:PFM   329->424 PF02978 * SRP_SPB 4e-20 53.1 %
:HMM:PFM   100->296 PF00448 * SRP54 1.5e-77 52.0 196/196  
:HMM:PFM   328->424 PF02978 * SRP_SPB 7.5e-34 49.5 97/104  
:HMM:PFM   5->82 PF02881 * SRP54_N 1.7e-21 37.3 75/75  
:BLT:SWISS 1->416 SRP54_HAEIN e-154 64.7 %
:PROS 269->282|PS00300|SRP54
:REPEAT 2|288->366|367->455

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30909.1 GT:GENE ffh GT:PRODUCT signal recognition particle GTPase GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1067617..1068993 GB:FROM 1067617 GB:TO 1068993 GB:DIRECTION + GB:GENE ffh GB:PRODUCT signal recognition particle GTPase GB:PROTEIN_ID ACD30909.1 GB:DB_XREF GI:187712612 GB:GENE:GENE ffh LENGTH 458 SQ:AASEQ MFTSLSEKLQSSFKKIKGQTSLTEENIQSALRDIRVSLLEADVALPVVKKFIANIKEKAIGEEVKKSLTPDQTFISFVKKEIEKALGEEAVPINLKTQPPAVILMAGLQGAGKTTSTAKLAKYLKEQHKKKVMVVSADVYRPAAIDQLRTLANSLNVEFFESDASQQPEDIVTAAIKTAKTKLIDVLIIDTAGRLHIDNDMMDEIKQIHKIAKPIETFFTVDSMTGQDAAVTAKAFNDALELTGVILTKTDGDARGGAALSIREITGKPIKFLGVGEKTDALKPFHPDRVASKILGMGDVLSLIESIEQKTEKKSAEQLTKKLKSGKSFDLEDFKAQIQQMKKMGGVGSIMSKLPNMPANLPGAVGDDMFKKIEAMIDSMTPLERKKPELIKHSRKQRIIKGSGTTIQDLNKLLQQHTQMKKMMKNVIGKKGGMANLMKRMSAMQGMANMPGLFGKRK GT:EXON 1|1-458:0| BL:SWS:NREP 1 BL:SWS:REP 1->416|SRP54_HAEIN|e-154|64.7|416/462| PROS 269->282|PS00300|SRP54|PDOC00272| NREPEAT 1 REPEAT 2|288->366|367->455| BL:PDB:NREP 1 BL:PDB:REP 2->427|2j289|e-154|62.4|426/430| RP:PDB:NREP 1 RP:PDB:REP 1->435|3dm5A|1e-51|36.1|415/416| RP:PFM:NREP 3 RP:PFM:REP 9->82|PF02881|5e-06|40.0|70/74|SRP54_N| RP:PFM:REP 100->295|PF00448|2e-51|53.3|195/196|SRP54| RP:PFM:REP 329->424|PF02978|4e-20|53.1|96/101|SRP_SPB| HM:PFM:NREP 3 HM:PFM:REP 100->296|PF00448|1.5e-77|52.0|196/196|SRP54| HM:PFM:REP 328->424|PF02978|7.5e-34|49.5|97/104|SRP_SPB| HM:PFM:REP 5->82|PF02881|1.7e-21|37.3|75/75|SRP54_N| GO:PFM:NREP 8 GO:PFM GO:0005515|"GO:protein binding"|PF02881|IPR013822| GO:PFM GO:0005525|"GO:GTP binding"|PF02881|IPR013822| GO:PFM GO:0006614|"GO:SRP-dependent cotranslational protein targeting to membrane"|PF02881|IPR013822| GO:PFM GO:0005525|"GO:GTP binding"|PF00448|IPR000897| GO:PFM GO:0006614|"GO:SRP-dependent cotranslational protein targeting to membrane"|PF00448|IPR000897| GO:PFM GO:0006614|"GO:SRP-dependent cotranslational protein targeting to membrane"|PF02978|IPR004125| GO:PFM GO:0008312|"GO:7S RNA binding"|PF02978|IPR004125| GO:PFM GO:0048500|"GO:signal recognition particle"|PF02978|IPR004125| RP:SCP:NREP 2 RP:SCP:REP 22->198|1wruA2|1e-34|11.8|169/174|b.106.1.1| RP:SCP:REP 298->427|1qzwA2|3e-35|28.5|130/138|a.36.1.1| HM:SCP:REP 1->94|1wgwA_|2.1e-25|50.0|94/0|a.24.13.1|1/1|Domain of the SRP/SRP receptor G-proteins| HM:SCP:REP 92->298|1ls1A2|9.8e-53|35.4|206/0|c.37.1.10|1/1|P-loop containing nucleoside triphosphate hydrolases| HM:SCP:REP 298->428|1qzxA2|3.5e-42|50.4|131/138|a.36.1.1|1/1|Signal peptide-binding domain| OP:NHOMO 2608 OP:NHOMOORG 1163 OP:PATTERN 22222222111222222222222222222222222222222222222222222222222222222-22 2232222222222222222-22222222222222222222222222122222222222222222222222222222222222233333222222222--222222222222222222222222222222222222222222---2223222222222222222222222222222222222222222222-33222222233332322323332233323233323333333322222222222222132222221222222222222222222222122222222222222222222222222222222222222222222233333333333333333333222333223333333322333323333222223222222222222222222222222222222222-22222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222333333222222222222222322222222333222222222322222222222222222222222233223222222222232233323222222333222233323323333333333232222222332322223333322333233222222-2222322222222222222222222222-22222222222222222222222222222222222222222222222221222222222222222222222222222222322222222222222222222122222223222223333232233332222222222222222222222322222222334222222221111--2222222223222222-22222222222222222223223333333222 2222223-622222222222222222222222222222112222223222222221222222222222222-2222222222222222-222222222222222222215334222211321213313-2C2-2232221212221222221232233224522223223812324444s44444569C2664432224 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccccccccccccEEEEEEccccccHHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHccEEEEccccccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHcccccEEEEccccccHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHcccEEEEEccccccccccccHHHHHHHHHcHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccHHHHHHHcccccccccccccHHHHHHHHHHHHcccHHHHHccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHcccccccccccHHHccc //