[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : fimT
DDBJ      :fimT         type IV pili, pilus assembly protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.24.1
:194 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  9->165 1oqwA_ d.24.1.1 * 4.1e-18 20.2 %
:HMM:PFM   47->167 PF12019 * GspH 5.4e-12 19.2 104/114  
:HMM:PFM   7->25 PF07963 * N_methyl 4e-07 52.6 19/20  
:PROS 7->27|PS00409|PROKAR_NTER_METHYL
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31170.1 GT:GENE fimT GT:PRODUCT type IV pili, pilus assembly protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1422838..1423422) GB:FROM 1422838 GB:TO 1423422 GB:DIRECTION - GB:GENE fimT GB:PRODUCT type IV pili, pilus assembly protein GB:PROTEIN_ID ACD31170.1 GB:DB_XREF GI:187712873 GB:GENE:GENE fimT LENGTH 194 SQ:AASEQ MIISKKKGFSLVETMVVIAIMTILMMAAISSFTFYYKTFAETRLTNLQKLIEYGVIKARTDNKTVIVCAATPDSFDGTGKLDGNSFACANSTSWVDDPIVAFESADGTDIYNGAEDTIIANMPQGHGGHIYVNLAGNPSSIRINPNGFMATGNGNITYCDKSNKYQAALITNLVGRVVYTDSPTKDGGGLYTCE GT:EXON 1|1-194:0| PROS 7->27|PS00409|PROKAR_NTER_METHYL|PDOC00342| TM:NTM 1 TM:REGION 13->35| SEG 14->29|tmvviaimtilmmaai| HM:PFM:NREP 2 HM:PFM:REP 47->167|PF12019|5.4e-12|19.2|104/114|GspH| HM:PFM:REP 7->25|PF07963|4e-07|52.6|19/20|N_methyl| HM:SCP:REP 9->165|1oqwA_|4.1e-18|20.2|124/144|d.24.1.1|1/1|Pili subunits| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-18,20-20,25-25,39-39,45-45,81-81,87-87,90-90,95-96,101-102,104-104,109-109,151-151,179-179,185-186| PSIPRED ccccccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccEEEEccccEEEEEEcccccccccEEEccccEEEccccccccccEEEEEcccccccccccccEEEEccccccccEEEEEEcccccEEEEccccEEEEccccEEEEccccccHHHHHHHHHHEEEEccccccccccEEEEc //