[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : fkpB
DDBJ      :fkpB         fkbp-type 16 kda peptidyl-prolyl cis-transisomerase
Swiss-Prot:             

Homologs  Archaea  26/68 : Bacteria  359/915 : Eukaryota  9/199 : Viruses  0/175   --->[See Alignment]
d.26.1
:154 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   20->143 1ix5A PDBj 2e-15 34.2 %
:RPS:PDB   1->147 3cgmA PDBj 6e-24 26.2 %
:RPS:SCOP  3->143 1ix5A  d.26.1.1 * 1e-24 28.7 %
:HMM:SCOP  2->143 1ix5A_ d.26.1.1 * 2.4e-29 38.0 %
:RPS:PFM   9->72 PF00254 * FKBP_C 1e-07 31.2 %
:HMM:PFM   4->75 PF00254 * FKBP_C 2.8e-14 30.6 72/96  
:HMM:PFM   103->153 PF06262 * DUF1025 0.0003 29.4 51/97  
:HMM:PFM   41->113 PF00117 * GATase 0.00052 20.5 73/192  
:BLT:SWISS 3->141 FKBX_SHIFL 4e-26 38.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30453.1 GT:GENE fkpB GT:PRODUCT fkbp-type 16 kda peptidyl-prolyl cis-transisomerase GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 475892..476356 GB:FROM 475892 GB:TO 476356 GB:DIRECTION + GB:GENE fkpB GB:PRODUCT fkbp-type 16 kda peptidyl-prolyl cis-transisomerase GB:PROTEIN_ID ACD30453.1 GB:DB_XREF GI:187712156 GB:GENE:GENE fkpB LENGTH 154 SQ:AASEQ MKIASDSFVKMHFKFRLKDGSIAEDTENYNRPFVFQMGQGCFTEKVENELVGTTIGETKRVVLMPEEAFGEKHPASIYSVPKYRFPKDMHLEEGLIVSFSQKDGSKLPGLITEINEQDVTVDFNHPLSGQIIVFEAKILDVAEKEEDLGEDITS GT:EXON 1|1-154:0| BL:SWS:NREP 1 BL:SWS:REP 3->141|FKBX_SHIFL|4e-26|38.1|139/149| BL:PDB:NREP 1 BL:PDB:REP 20->143|1ix5A|2e-15|34.2|117/151| RP:PDB:NREP 1 RP:PDB:REP 1->147|3cgmA|6e-24|26.2|141/157| RP:PFM:NREP 1 RP:PFM:REP 9->72|PF00254|1e-07|31.2|64/91|FKBP_C| HM:PFM:NREP 3 HM:PFM:REP 4->75|PF00254|2.8e-14|30.6|72/96|FKBP_C| HM:PFM:REP 103->153|PF06262|0.0003|29.4|51/97|DUF1025| HM:PFM:REP 41->113|PF00117|0.00052|20.5|73/192|GATase| GO:PFM:NREP 1 GO:PFM GO:0006457|"GO:protein folding"|PF00254|IPR001179| RP:SCP:NREP 1 RP:SCP:REP 3->143|1ix5A|1e-24|28.7|136/151|d.26.1.1| HM:SCP:REP 2->143|1ix5A_|2.4e-29|38.0|137/151|d.26.1.1|1/1|FKBP-like| OP:NHOMO 588 OP:NHOMOORG 394 OP:PATTERN --1-11-----------------1-----1--1--2221-1-11-1112-31--1112121------- ------------------------------------------------------------------------------1122---11-11-1-111-------1111211---------------1-1111111-1---11-----111-11-------------------------------111----1-----------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------1------------------1---------------------------1-1----1-----------1--------111----------------------------------------------1----11111222222211111222222222222222212222-12--122-1-221121121---------1111111221111-111--212221332111121-21111111111111111111111-111122-123222233222211111121112212---1212------21222222222222222-2222222222222222222222222222222222222222222122232221-211111111111--13----------3132---11111111---122222222212122222222122222222111111111211111111111111--11-11-11-----1--11--11---------1--------------------------11-11-------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111912111-------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 147 STR:RPRED 95.5 SQ:SECSTR ccccTTEEEEEEEEEEEcTTEEEEEEETTccEEEEETTcccccHHHHHHHTTccTTcEEEEEEcGGGTTccccGGGEEEEEGGGccTTccccTTcEEEEEETTTEEEEEEEEEEETTEEEEEcccTTTTccEEEEEEEEEEEEccHH####### PSIPRED cccccccEEEEEEEEEEccccEEEEEccccccEEEEEcccccHHHHHHHHHccccccEEEEEEcHHHcccccccccEEEEEHHHcccccccccccEEEEEcccccEEEEEEEEEcccEEEEEccccccccEEEEEEEEEEEEcccHHHHHHHcc //