[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : fmt
DDBJ      :fmt          methionyl-tRNA formyltransferase
Swiss-Prot:FMT_FRATM    RecName: Full=Methionyl-tRNA formyltransferase;         EC=2.1.2.9;

Homologs  Archaea  2/68 : Bacteria  899/915 : Eukaryota  165/199 : Viruses  0/175   --->[See Alignment]
b.46.1c.65.1
:313 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->302 2fmtA PDBj 5e-71 46.5 %
:RPS:PDB   1->299 2cfiA PDBj 5e-76 26.1 %
:RPS:SCOP  48->201 1zghA2  c.65.1.1 * 7e-42 25.5 %
:RPS:SCOP  205->312 1fmtA1  b.46.1.1 * 1e-24 32.7 %
:HMM:SCOP  1->204 1fmtA2 c.65.1.1 * 1.3e-62 40.9 %
:HMM:SCOP  205->313 1fmtA1 b.46.1.1 * 6.6e-26 36.1 %
:RPS:PFM   29->184 PF00551 * Formyl_trans_N 5e-31 47.4 %
:RPS:PFM   204->301 PF02911 * Formyl_trans_C 2e-16 37.8 %
:HMM:PFM   5->183 PF00551 * Formyl_trans_N 6.9e-47 38.3 175/181  
:HMM:PFM   204->302 PF02911 * Formyl_trans_C 1.1e-28 35.4 99/100  
:BLT:SWISS 1->313 FMT_FRATM 0.0 100.0 %
:PROS 136->159|PS00373|GART

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30824.1 GT:GENE fmt GT:PRODUCT methionyl-tRNA formyltransferase GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 964323..965264 GB:FROM 964323 GB:TO 965264 GB:DIRECTION + GB:GENE fmt GB:PRODUCT methionyl-tRNA formyltransferase GB:PROTEIN_ID ACD30824.1 GB:DB_XREF GI:187712527 GB:GENE:GENE fmt LENGTH 313 SQ:AASEQ MKKLNIIFAGTPDISAQVLKDLYKSQYNIQAVLTQPDRAKGRGKKVQFSPVKEVALANHTPVFQPLSFKKNPEVLEQIKQLKPDVIVVIAYGIIVPQEFLDIPRYGCLNIHVSLLPKWRGAAPIQRAIQAGDTKTGVCIMQMDAGLDTGDILNTLEIEIQETDTSQTLHDKFAKLSIKPLLETLEKIEIIKPEPQQGEPTYAHKITKQEGLIDFTKSAWQISCHIRAFTPWPGAYFILDDEAIKVGEFEILYQNTDNRKAGTIIDIYRSGFDIATSDKIIRFRQLQFPNKKMLNIVDILNGKDLDKYIGYKLG GT:EXON 1|1-313:0| SW:ID FMT_FRATM SW:DE RecName: Full=Methionyl-tRNA formyltransferase; EC=2.1.2.9; SW:GN Name=fmt; OrderedLocusNames=FTM_0883; SW:KW Complete proteome; Methyltransferase; Protein biosynthesis;Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->313|FMT_FRATM|0.0|100.0|313/313| GO:SWS:NREP 3 GO:SWS GO:0008168|"GO:methyltransferase activity"|Methyltransferase| GO:SWS GO:0006412|"GO:translation"|Protein biosynthesis| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 136->159|PS00373|GART|PDOC00319| BL:PDB:NREP 1 BL:PDB:REP 2->302|2fmtA|5e-71|46.5|299/314| RP:PDB:NREP 1 RP:PDB:REP 1->299|2cfiA|5e-76|26.1|291/310| RP:PFM:NREP 2 RP:PFM:REP 29->184|PF00551|5e-31|47.4|152/179|Formyl_trans_N| RP:PFM:REP 204->301|PF02911|2e-16|37.8|98/100|Formyl_trans_C| HM:PFM:NREP 2 HM:PFM:REP 5->183|PF00551|6.9e-47|38.3|175/181|Formyl_trans_N| HM:PFM:REP 204->302|PF02911|1.1e-28|35.4|99/100|Formyl_trans_C| GO:PFM:NREP 4 GO:PFM GO:0009058|"GO:biosynthetic process"|PF00551|IPR002376| GO:PFM GO:0016742|"GO:hydroxymethyl-, formyl- and related transferase activity"|PF00551|IPR002376| GO:PFM GO:0009058|"GO:biosynthetic process"|PF02911|IPR005793| GO:PFM GO:0016742|"GO:hydroxymethyl-, formyl- and related transferase activity"|PF02911|IPR005793| RP:SCP:NREP 2 RP:SCP:REP 48->201|1zghA2|7e-42|25.5|149/164|c.65.1.1| RP:SCP:REP 205->312|1fmtA1|1e-24|32.7|107/108|b.46.1.1| HM:SCP:REP 1->204|1fmtA2|1.3e-62|40.9|203/206|c.65.1.1|1/1|Formyltransferase| HM:SCP:REP 205->313|1fmtA1|6.6e-26|36.1|108/108|b.46.1.1|1/1|FMT C-terminal domain-like| OP:NHOMO 1499 OP:NHOMOORG 1066 OP:PATTERN ---------------------------------------------1-----1---------------- 1111121222231221111-11111211111111111222112211221112222112221211223122111111111111111121211111111--11123111122111111111111111111111111211221111111-1111111111111111111111111111111111111111111112222222323223222312111222212112121111112221111111111111122222211111111112222111111111111112111111111111111111111111111111111111111111111111111211111111121212111111111111111111111111111111111211111111111111122222222221-11211212111211121121112211111211112221311111111111111111111111111111111111111111111111211111411222222222222222122222222222223222111111111111121111221111111211111221112111212211222331221111112111211111112211111111111121112211221211231111112222112211221-1111111111111222222222222222-222222222222222222222222252212222222222222122121122222222222222221121111111221111111111111111121111111111122112222122211111112222222222211112222222112211111111111111211111111111111111111----1-111-111---1111111112111121222121 1---13------111111111-1111-11-111111111111111111112-1--1--1111111----11-111-11-1111111-1--1111111111--1111-11142333312311231322628H3-446112143243-33213125222232122322-32321141122171111111111111121-11 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 310 STR:RPRED 99.0 SQ:SECSTR ccccEEEEEccHHHHHHHHHHHHHTTcEEEEEEEcccccccccccHTTcHHHHHHHHHTccEEEccccEETHHHHHHHHHTcccEEEEccccccccHHHHTccTTcEEEEEcccTTTTccccHHHHHHHTTccEEEEEEEEcccccccccEEEEEEEEccTTccHHHHHHHTTHHHHHHHHHHHHHHHccccccccTTccccccccGGGGcccccccHHHHHHHHHTTTTTTcEEEEETTEEEEEEEEEcccTTcTccccEEEETEETEEEEEcTTccEEEEEEEEcTTccEEEGGGTTHHHTccT##Tccc# DISOP:02AL 313-314| PSIPRED cccEEEEEEcccHHHHHHHHHHHHccccEEEEEEccccHHHHcccccccHHHHHHHHccccEEccccccccHHHHHHHHHccccEEEEccccccccHHHHHHccccEEEEccHHccccccccHHHHHHHccccEEEEEEEEEccccccccEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHEEEEccccHHHHHHHHccccccccEEEEEccEEEEEEEEEEcccccccccccEEEEEcccEEEEEccccEEEEEEEEccccccccHHHHHcccccccccccccc //