[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : folC
DDBJ      :folC         folylpoly-gamma-glutamate synthetase/ dihydrofolate synthetase
Swiss-Prot:             

Homologs  Archaea  10/68 : Bacteria  701/915 : Eukaryota  98/199 : Viruses  0/175   --->[See Alignment]
c.59.1c.72.2
:393 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   39->323 1w7kA PDBj 7e-24 30.7 %
:RPS:PDB   39->386 1e8cA PDBj 2e-21 13.2 %
:RPS:SCOP  32->214 1o5zA2  c.72.2.2 * 4e-22 27.3 %
:RPS:SCOP  254->389 1j6uA2  c.59.1.1 * 1e-10 19.2 %
:HMM:SCOP  35->255 1o5zA2 c.72.2.2 * 4.5e-55 37.6 %
:HMM:SCOP  253->389 1o5zA1 c.59.1.2 * 1.7e-18 28.0 %
:HMM:PFM   42->177 PF08245 * Mur_ligase_M 2.2e-11 31.9 91/188  
:HMM:PFM   265->309 PF02875 * Mur_ligase_C 5.2e-05 25.6 43/91  
:BLT:SWISS 39->383 FOLC_HAEIN 4e-32 29.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30351.1 GT:GENE folC GT:PRODUCT folylpoly-gamma-glutamate synthetase/ dihydrofolate synthetase GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(323143..324324) GB:FROM 323143 GB:TO 324324 GB:DIRECTION - GB:GENE folC GB:PRODUCT folylpoly-gamma-glutamate synthetase/ dihydrofolate synthetase GB:PROTEIN_ID ACD30351.1 GB:DB_XREF GI:187712054 GB:GENE:GENE folC LENGTH 393 SQ:AASEQ MSVEIKIAKLMAKPDALYCDLLDLSLILSRFNFAKKFKVITIAGTNGKGTTVAMLEELLVTNNKNVLSHTSPHVFKFNERISLNKQPICDSVLLEILERLEELAPEYRLSYYQIAFLCLCIYSQRVELDYLILEVGIGGRLDAANIIDADITAITNIDFDHCEILGDTLDKIGFEKAGISRPQVPLFLGSQIPQSVYEYAQTIGAVIYQNSYEYSSRQCFTHSYNIAMGIAEYLFYRMQISYIPNLEDIRARARFATLKNDSLNNSYVVVDVAHNPASVRHLFELLESKFAGKNIRYEAIFGILATKDIREVLNIAKQHVYKWDVIDLKYLDSRAADLEKIKQEFKLQQIIRVDYNKDLSSVYLAKKDTLTVVFGSFVLAGEFIRHYEKYTSK GT:EXON 1|1-393:0| BL:SWS:NREP 1 BL:SWS:REP 39->383|FOLC_HAEIN|4e-32|29.4|344/437| SEG 15->28|dalycdlldlslil| SEG 93->106|lleilerleelape| SEG 142->158|daaniidaditaitnid| BL:PDB:NREP 1 BL:PDB:REP 39->323|1w7kA|7e-24|30.7|280/410| RP:PDB:NREP 1 RP:PDB:REP 39->386|1e8cA|2e-21|13.2|303/482| HM:PFM:NREP 2 HM:PFM:REP 42->177|PF08245|2.2e-11|31.9|91/188|Mur_ligase_M| HM:PFM:REP 265->309|PF02875|5.2e-05|25.6|43/91|Mur_ligase_C| RP:SCP:NREP 2 RP:SCP:REP 32->214|1o5zA2|4e-22|27.3|176/284|c.72.2.2| RP:SCP:REP 254->389|1j6uA2|1e-10|19.2|125/134|c.59.1.1| HM:SCP:REP 35->255|1o5zA2|4.5e-55|37.6|221/296|c.72.2.2|1/1|MurD-like peptide ligases, catalytic domain| HM:SCP:REP 253->389|1o5zA1|1.7e-18|28.0|125/137|c.59.1.2|1/1|MurD-like peptide ligases, peptide-binding domain| OP:NHOMO 908 OP:NHOMOORG 809 OP:PATTERN ------------------------11111-11-----------------------------111---- --1-1--------------------------------------1--------1111-1----------------------11-1111111111111---11111111111--------------1-----1-1-11111111111111112211111-1-1-11111-1--1---111-1-1122111111-1111111111111111111111111111121111111111111111111111111111111-11111211111111111-11-11111111-112222222222111222222222222222222222221-12111111111111-1111111-1--1-11-1---111-1--1111-12111---1-11111----1--1-1-111111111111-1-------111-211111111111----2111111111111111111----1-111111111111--11111111111111-11-11111111111111111111111111111-1111111111111121111111111111111111111111111111-11111-11-1---11111111111111111-111111111111111111111-1111111111111111111111111111-1111111-1111111-11111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--1111111111111111111111111111111111111111111-111111111111111111111111111111----------------11--1-1---1--------1-------1111111111121 11--111-3-----1--------212-11----1-1----------22------11---221----11-11111111-1111111------1--11---1-1--11-----111-12-1-11112--3-892--11----1--2--1-111--1---11122-211--2--3311---17311121--2-4411-111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 362 STR:RPRED 92.1 SQ:SECSTR ##############################HHHHHccEHHHHHHHTTccEEEETTEEEETTcccccccccccHHHHHHHHHHHHHTTHTcTTcHHHHHHHHHHTTTcccccccEEEEEccccHTTccEccEEEEccHHHHHTTTTTTccccEEEEccccccHHHHccHHHHHHHHHHHTccccEEEEHHTTcTTcEEEEcccccTTTccEEEEEEEEEEccccEEEEEEETTccEEEEEcccHHHHHHHHHGGGccccTTccTTccEEEEEccccHHHHHHHHHHHHHTccccEEEEEEEccccccccTHHHHHHHHHHHccEEEEccccccccTccHHHHHHHHHTTccGGGcEEccHHHHHHccTTcEEEEEccTTccEEEETTHHHHHH# PSIPRED ccccccHHHHHHHHHcccccHHHHHHHHHHcccHHccEEEEEEccccHHHHHHHHHHHHHHccccEEEEEccEEEEEEcEEEEccEEccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccEEEEEcccccccHHcccccccEEEEccccHHHHHHHcccHHHHHHHHHHHHccccEEEEccccHHHHHHHHHHHccEEEEEcccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHccccccEEEEEEccccccEEEEEccccHHHHHHHHHHHHHHcccccccEEEEEcccccccHHHHHHHHHHHccEEEEEEEcccccccccHHHHHHHcccccEEEEcHHHHHHHHHHcccccEEEEEccHHHHHHHHHHHHHHccc //