[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : folD
DDBJ      :folD         methyleneTHF enzyme/ methenyltetrahydrofolate cyclohydrolase/ methylenetetrahydrofolate dehydrogenase
Swiss-Prot:FOLD_FRATM   RecName: Full=Bifunctional protein folD;Includes:  RecName: Full=Methylenetetrahydrofolate dehydrogenase;           EC=1.5.1.5;Includes:  RecName: Full=Methenyltetrahydrofolate cyclohydrolase;           EC=3.5.4.9;

Homologs  Archaea  27/68 : Bacteria  887/915 : Eukaryota  187/199 : Viruses  0/175   --->[See Alignment]
c.2.1c.58.1
:282 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   3->279 1b0aA PDBj 4e-74 51.4 %
:RPS:PDB   2->280 1b0aA PDBj 1e-45 50.0 %
:RPS:SCOP  2->146 1edzA2  c.58.1.2 * 4e-35 25.5 %
:RPS:SCOP  121->274 1a4iA1  c.2.1.7 * 1e-16 44.0 %
:HMM:SCOP  1->120 1a4iA2 c.58.1.2 * 2.6e-40 54.2 %
:HMM:SCOP  121->278 1a4iA1 c.2.1.7 * 2.2e-48 45.6 %
:RPS:PFM   2->119 PF00763 * THF_DHG_CYH 3e-30 51.7 %
:RPS:PFM   123->278 PF02882 * THF_DHG_CYH_C 1e-45 59.4 %
:HMM:PFM   122->279 PF02882 * THF_DHG_CYH_C 3.4e-70 59.2 157/161  
:HMM:PFM   3->119 PF00763 * THF_DHG_CYH 5.1e-46 55.2 116/117  
:BLT:SWISS 1->282 FOLD_FRATM e-151 100.0 %
:PROS 74->99|PS00766|THF_DHG_CYH_1
:PROS 258->266|PS00767|THF_DHG_CYH_2
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30499.1 GT:GENE folD GT:PRODUCT methyleneTHF enzyme/ methenyltetrahydrofolate cyclohydrolase/ methylenetetrahydrofolate dehydrogenase GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 525084..525932 GB:FROM 525084 GB:TO 525932 GB:DIRECTION + GB:GENE folD GB:PRODUCT methyleneTHF enzyme/ methenyltetrahydrofolate cyclohydrolase/ methylenetetrahydrofolate dehydrogenase GB:PROTEIN_ID ACD30499.1 GB:DB_XREF GI:187712202 GB:GENE:GENE folD LENGTH 282 SQ:AASEQ MILIDGKSLSKDLKERLVTQVQEYKHHTAITPKLVAIIVGNDPASKTYVDSKEKACAQVGIDSQVITLPEHTTESELLELIDQLNNDSSVHAILVQLPLPAHINKNNVIYSIKPEKDVDGFHPTNVGRLQLRDKKCLESCTPKGIMTMLREYGIKTEGAYAVVVGASNVVGKPVSQLLLNAKATVTTCHRFTTDLKSHTTKADILIVAVGKPNFITADMVKEGAVVIDVGINHVDGKIVGDVDFAAVKDKVAAITPVPGGVGPMTITELLYNTFQCAQELNR GT:EXON 1|1-282:0| SW:ID FOLD_FRATM SW:DE RecName: Full=Bifunctional protein folD;Includes: RecName: Full=Methylenetetrahydrofolate dehydrogenase; EC=1.5.1.5;Includes: RecName: Full=Methenyltetrahydrofolate cyclohydrolase; EC=3.5.4.9; SW:GN Name=folD; OrderedLocusNames=FTM_0480; SW:KW Amino-acid biosynthesis; Complete proteome; Histidine biosynthesis;Hydrolase; Methionine biosynthesis; Multifunctional enzyme; NADP;One-carbon metabolism; Oxidoreductase; Purine biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->282|FOLD_FRATM|e-151|100.0|282/282| GO:SWS:NREP 9 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0000105|"GO:histidine biosynthetic process"|Histidine biosynthesis| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0009086|"GO:methionine biosynthetic process"|Methionine biosynthesis| GO:SWS GO:0003824|"GO:catalytic activity"|Multifunctional enzyme| GO:SWS GO:0006730|"GO:one-carbon metabolic process"|One-carbon metabolism| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0006164|"GO:purine nucleotide biosynthetic process"|Purine biosynthesis| PROS 74->99|PS00766|THF_DHG_CYH_1|PDOC00616| PROS 258->266|PS00767|THF_DHG_CYH_2|PDOC00616| SEG 239->253|vgdvdfaavkdkvaa| BL:PDB:NREP 1 BL:PDB:REP 3->279|1b0aA|4e-74|51.4|276/287| RP:PDB:NREP 1 RP:PDB:REP 2->280|1b0aA|1e-45|50.0|278/287| RP:PFM:NREP 2 RP:PFM:REP 2->119|PF00763|3e-30|51.7|118/118|THF_DHG_CYH| RP:PFM:REP 123->278|PF02882|1e-45|59.4|155/160|THF_DHG_CYH_C| HM:PFM:NREP 2 HM:PFM:REP 122->279|PF02882|3.4e-70|59.2|157/161|THF_DHG_CYH_C| HM:PFM:REP 3->119|PF00763|5.1e-46|55.2|116/117|THF_DHG_CYH| GO:PFM:NREP 4 GO:PFM GO:0003824|"GO:catalytic activity"|PF00763|IPR000672| GO:PFM GO:0009396|"GO:folic acid and derivative biosynthetic process"|PF00763|IPR000672| GO:PFM GO:0003824|"GO:catalytic activity"|PF02882|IPR000672| GO:PFM GO:0009396|"GO:folic acid and derivative biosynthetic process"|PF02882|IPR000672| RP:SCP:NREP 2 RP:SCP:REP 2->146|1edzA2|4e-35|25.5|141/146|c.58.1.2| RP:SCP:REP 121->274|1a4iA1|1e-16|44.0|150/160|c.2.1.7| HM:SCP:REP 1->120|1a4iA2|2.6e-40|54.2|120/125|c.58.1.2|1/1|Aminoacid dehydrogenase-like, N-terminal domain| HM:SCP:REP 121->278|1a4iA1|2.2e-48|45.6|158/170|c.2.1.7|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 1616 OP:NHOMOORG 1101 OP:PATTERN ------------------11111-21111111-----------11-1111111--------111--11 1111211111111111111-11111111111111111222122111111111221111112221222211111111111112311111111111111--1111111111111111111111111111111111111111111121111111111111111111111111111111111111112211111121111111111111111111111111111111111111111211111111111111111111111111111221111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111222111211111111111111111111111111111111111111111111111-1-------1211311122211322111111121111313111111111111-11111111111111111111111111111111112311112211111111111111121111111111111111112111111111111111111111-1111111111111111111111111212122111111122111111111111111111111111111111111112111111111111111111111111-1111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111121111111111111112111111111111332211122211111111121111111111111111111111111111111111111111111111111----1-111-111---111111---1111111111111 ----332-311-12222-21122323222222211111111112121222332212211222333333233232333-3333333233-211211211113-1435-16243747743443443764F2Kd5-8563442624554432452364553333223242633D21121333Y2222163441431247433 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 279 STR:RPRED 98.9 SQ:SECSTR #EEccHHHHHHHHHHHHHHHHHHHHHTTccccEEEEEEEcccHHHHHHHHHHHHHHHHHTcEEccEEEcTTccHHHHHHHHHHHHTcTTccEEEEcccccTTccHHHHHTTccTTTcTTcccHHHHHHHHTTcccccccHHHHHHHHHHHHTTcccTTcEEEEEcccTTTHHHHHHHHHTTTcEEEEEccccccHHHHHHHccEEEEccccTTcccTTTccTTcEEEEccEEcTTccEEccccHHHHHHHccEEcccccccHHHHHHHHHHHHHHHHHHT## PSIPRED cEEEEHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEcccHHHHHHHHHHHHHHHHHccEEEEEEccccccHHHHHHHHHHHcccccccEEEEEccccccccHHHHHHHccHHHccccccHHHHHHHHHccccccccccHHHHHHHHHHccccccccEEEEEccccccHHHHHHHHHHcccEEEEEEcccccHHHHHHHccEEEEEccccccccHHHcccccEEEEEEEEEEccEEEEEEccHHHHHHccEEccccccccHHHHHHHHHHHHHHHHHHcc //