[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : fopA
DDBJ      :fopA         outer membrane protein FopA
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  97/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.79.7f.4.1
:392 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   268->390 2k1sA PDBj 3e-07 31.4 %
:RPS:PDB   279->391 3cypC PDBj 1e-17 15.0 %
:RPS:SCOP  63->210 1bxwA  f.4.1.1 * 2e-05 16.4 %
:RPS:SCOP  271->387 1r1mA  d.79.7.1 * 1e-19 24.8 %
:HMM:SCOP  70->215 1g90A_ f.4.1.1 * 9.4e-13 19.4 %
:HMM:SCOP  267->384 1r1mA_ d.79.7.1 * 3e-19 28.9 %
:RPS:PFM   282->369 PF00691 * OmpA 4e-05 34.9 %
:HMM:PFM   282->369 PF00691 * OmpA 2.6e-18 28.9 83/97  
:HMM:PFM   56->93 PF09027 * GTPase_binding 1.6e-05 31.6 38/66  
:HMM:PFM   160->212 PF01389 * OmpA_membrane 0.00065 13.2 53/200  
:BLT:SWISS 163->369 OMPA_SERMA 4e-13 33.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31118.1 GT:GENE fopA GT:PRODUCT outer membrane protein FopA GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1350948..1352126) GB:FROM 1350948 GB:TO 1352126 GB:DIRECTION - GB:GENE fopA GB:PRODUCT outer membrane protein FopA GB:PROTEIN_ID ACD31118.1 GB:DB_XREF GI:187712821 GB:GENE:GENE fopA LENGTH 392 SQ:AASEQ MRLKSIVIATTVLLGSATASIAAGSDNIDTSANTNSATTQSSGFAANNFIAPFANTYSALTNKDNTWGPQDRIGQWYLGVDANGLAGTPNSPSGAGANFTIGYNINKYFAVQYNQLVGRVFAGLGEGVVNFSNNTMFTPYAAGGAGWANLAGQATGAWDVGGGLKFELSRNVQASVDYRYIQTMAPSNISGANGRAGTNMIGAGLTWFFGGKDTTNNDTGNIQDNGATTAAQTVAMPTIDESKYVLPAGIKQCEGNFNLTEDGVACYTVNGDDVTVYLDIKFAYDKATLNAKGKKAIASFVNFIKDSNISSVTVKGYASQGQTGSEFDIYNQKLSEKRAQAVADYMKQLGLDSEKIITKGFGYNDTLSGIHKSDPRNQRVEASVSAPLKEAN GT:EXON 1|1-392:0| BL:SWS:NREP 1 BL:SWS:REP 163->369|OMPA_SERMA|4e-13|33.3|159/359| TM:NTM 1 TM:REGION 4->26| SEG 30->42|tsantnsattqss| SEG 44->55|faannfiapfan| SEG 141->154|aaggagwanlagqa| BL:PDB:NREP 1 BL:PDB:REP 268->390|2k1sA|3e-07|31.4|118/149| RP:PDB:NREP 1 RP:PDB:REP 279->391|3cypC|1e-17|15.0|113/134| RP:PFM:NREP 1 RP:PFM:REP 282->369|PF00691|4e-05|34.9|86/97|OmpA| HM:PFM:NREP 3 HM:PFM:REP 282->369|PF00691|2.6e-18|28.9|83/97|OmpA| HM:PFM:REP 56->93|PF09027|1.6e-05|31.6|38/66|GTPase_binding| HM:PFM:REP 160->212|PF01389|0.00065|13.2|53/200|OmpA_membrane| GO:PFM:NREP 1 GO:PFM GO:0009279|"GO:cell outer membrane"|PF00691|IPR006665| RP:SCP:NREP 2 RP:SCP:REP 63->210|1bxwA|2e-05|16.4|146/172|f.4.1.1| RP:SCP:REP 271->387|1r1mA|1e-19|24.8|113/140|d.79.7.1| HM:SCP:REP 70->215|1g90A_|9.4e-13|19.4|144/0|f.4.1.1|1/1|OMPA-like| HM:SCP:REP 267->384|1r1mA_|3e-19|28.9|114/140|d.79.7.1|1/1|OmpA-like| OP:NHOMO 112 OP:NHOMOORG 97 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------1---11--1---1-----------------2-------------1------------------1----11--11-----------------------------------------------------------11---111111111111-11111111111111111111-1-----1-11111111111111111111111-------------------------------------------------------12-----1111-11111-11223323322----------11---------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 174 STR:RPRED 44.4 SQ:SECSTR #########################################################################################################################################################################################################################EcccccTTEEccccTTccTTcEEEEcccTTEEEEEEEEEccTccTcccEEccEEEEEEEEEEEcccTTcccccHHHHHHHHHHHHHHTTcTTcEEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHTTcccTTEEEEEcTTccccccTTHHHHHTcEEEEEEEccHHHH# PSIPRED ccHHHHHHHHHHHHHHHHHHHHccccHHHHHcccHHHHHHHHHHHEEEEEEcccccccccccccccEEEEEEEEEEEEcccccccccccccccccEEEEEEcccccccEEEEcccccccccccccccEEEEccccEEEEEEEEEEEEEEEcccccccEEEEEEEEEEEcHHHEEEEEEEEEEccccccccccccccccEEEEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccEEEEEEEEEEccccHHccHHHHHHHHHHHHHHHHcccEEEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHccccHHHEEEEEccccccccccccccccccEEEEEEEccHHHcc //