[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : frr
DDBJ      :frr          ribosome recycling factor
Swiss-Prot:RRF_FRATW    RecName: Full=Ribosome-recycling factor;         Short=RRF;AltName: Full=Ribosome-releasing factor;

Homologs  Archaea  0/68 : Bacteria  907/915 : Eukaryota  67/199 : Viruses  0/175   --->[See Alignment]
d.67.3
:185 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->185 1is1A PDBj 7e-56 53.0 %
:RPS:PDB   2->183 1dd5A PDBj 4e-60 41.8 %
:RPS:SCOP  2->183 1dd5A  d.67.3.1 * 1e-60 41.8 %
:HMM:SCOP  1->185 1is1A_ d.67.3.1 * 1.5e-64 56.8 %
:RPS:PFM   23->183 PF01765 * RRF 1e-35 53.4 %
:HMM:PFM   20->183 PF01765 * RRF 2.4e-65 59.1 164/165  
:BLT:SWISS 1->185 RRF_FRATW 3e-94 100.0 %
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31358.1 GT:GENE frr GT:PRODUCT ribosome recycling factor GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1644749..1645306) GB:FROM 1644749 GB:TO 1645306 GB:DIRECTION - GB:GENE frr GB:PRODUCT ribosome recycling factor GB:PROTEIN_ID ACD31358.1 GB:DB_XREF GI:187713061 GB:GENE:GENE frr LENGTH 185 SQ:AASEQ MINDILKDAENRMKKSLEVLADDLAKIRTGRAHPDLLAHVTIDYYGVETPITQAANITVLDARTLGITPWEKGLSSKIEKAILTSDLGLNPTNLGDSLRVPMPALNEERRKELVKLVKSETEAGRVSIRNIRRDANGDIKELLKEKEITEDQAKKAEDDIQKITDKMIAQADALAAKKEQDLMAV GT:EXON 1|1-185:0| SW:ID RRF_FRATW SW:DE RecName: Full=Ribosome-recycling factor; Short=RRF;AltName: Full=Ribosome-releasing factor; SW:GN Name=frr; OrderedLocusNames=FTW_1766; SW:KW Complete proteome; Cytoplasm; Protein biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->185|RRF_FRATW|3e-94|100.0|185/185| GO:SWS:NREP 2 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0006412|"GO:translation"|Protein biosynthesis| COIL:NAA 40 COIL:NSEG 1 COIL:REGION 133->172| SEG 139->148|ikellkekei| BL:PDB:NREP 1 BL:PDB:REP 1->185|1is1A|7e-56|53.0|185/185| RP:PDB:NREP 1 RP:PDB:REP 2->183|1dd5A|4e-60|41.8|182/184| RP:PFM:NREP 1 RP:PFM:REP 23->183|PF01765|1e-35|53.4|161/165|RRF| HM:PFM:NREP 1 HM:PFM:REP 20->183|PF01765|2.4e-65|59.1|164/165|RRF| GO:PFM:NREP 1 GO:PFM GO:0006412|"GO:translation"|PF01765|IPR002661| RP:SCP:NREP 1 RP:SCP:REP 2->183|1dd5A|1e-60|41.8|182/184|d.67.3.1| HM:SCP:REP 1->185|1is1A_|1.5e-64|56.8|185/185|d.67.3.1|1/1|Ribosome recycling factor, RRF| OP:NHOMO 1009 OP:NHOMOORG 974 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 ----111-----111---------------------------------------------------------11--------------------------11-111-141-----111-1-11111-1-421-121-1-11-111-1---1--1-11-1----------------21229222212222-214221111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 185 STR:RPRED 100.0 SQ:SECSTR cccHHHHHHHHHHHHHHHHHHHHHHHcccccccGGGGTTcEEEETTEEEEGGGcEEEEEccTTEEEEEEccTTHHHHHHHHHHHcccccccEEccccEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc DISOP:02AL 185-186| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHccEEEEEccccEEHHHEEEEEcccccEEEEEEccHHHHHHHHHHHHHccccccccccccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //