[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ftnA
DDBJ      :ftnA         ferric iron binding protein, ferritin-like protein
Swiss-Prot:             

Homologs  Archaea  25/68 : Bacteria  354/915 : Eukaryota  56/199 : Viruses  0/175   --->[See Alignment]
a.25.1
:166 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->166 2jd60 PDBj 3e-42 50.3 %
:RPS:PDB   1->165 3bveF PDBj 2e-27 33.9 %
:RPS:SCOP  2->160 1eumA  a.25.1.1 * 5e-49 28.3 %
:HMM:SCOP  1->158 2ceiA1 a.25.1.1 * 7.8e-47 40.5 %
:RPS:PFM   7->129 PF00210 * Ferritin 9e-11 34.1 %
:HMM:PFM   8->143 PF00210 * Ferritin 1.3e-38 37.8 135/142  
:BLT:SWISS 1->162 FTN_STAHJ 6e-33 42.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31081.1 GT:GENE ftnA GT:PRODUCT ferric iron binding protein, ferritin-like protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1289455..1289955 GB:FROM 1289455 GB:TO 1289955 GB:DIRECTION + GB:GENE ftnA GB:PRODUCT ferric iron binding protein, ferritin-like protein GB:PROTEIN_ID ACD31081.1 GB:DB_XREF GI:187712784 GB:GENE:GENE ftnA LENGTH 166 SQ:AASEQ MISKRLLDALNDQFNYELESANIYLAMAGYTADLGLGGFTNWFMAQYEEELFHAKKIMKFISDKNGRIEVKSVAAPQNNFNSLLEVFQATLVHEQEVSTRFYDLMNIALEEKEHSTKSFLQWFIDEQVEEEATVGDMINKIKLVKDSGLYLLDQEAAKRNFNAPSL GT:EXON 1|1-166:0| BL:SWS:NREP 1 BL:SWS:REP 1->162|FTN_STAHJ|6e-33|42.6|162/166| BL:PDB:NREP 1 BL:PDB:REP 1->166|2jd60|3e-42|50.3|163/167| RP:PDB:NREP 1 RP:PDB:REP 1->165|3bveF|2e-27|33.9|165/173| RP:PFM:NREP 1 RP:PFM:REP 7->129|PF00210|9e-11|34.1|123/141|Ferritin| HM:PFM:NREP 1 HM:PFM:REP 8->143|PF00210|1.3e-38|37.8|135/142|Ferritin| GO:PFM:NREP 2 GO:PFM GO:0006879|"GO:cellular iron ion homeostasis"|PF00210|IPR008331| GO:PFM GO:0008199|"GO:ferric iron binding"|PF00210|IPR008331| RP:SCP:NREP 1 RP:SCP:REP 2->160|1eumA|5e-49|28.3|159/161|a.25.1.1| HM:SCP:REP 1->158|2ceiA1|7.8e-47|40.5|158/0|a.25.1.1|1/1|Ferritin-like| OP:NHOMO 591 OP:NHOMOORG 435 OP:PATTERN --1----------------1---1--------111--11111111--11111---1--111-----11 -----1111111111--11-11--1111111111111122------1-----111-11----11112-----------1-111-----1122-2111--1-21-1111-1--------------111-1111--1111111---1----1--------111----1------2---1-2---1---------1-11111111-11111111----111---1----------1111111111111111-1111----------------------------------------------------------------------111111111111-1-1111-111111111----11-----11-11111-11-----------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------1-1111-11111-1111-1111--1----1-----111111211111111-------11----1----11111--1111111111111------------1111-212222222222-22222222222222222211111111112111111111111111212222211111111111111--1---------------22222222222-222---------1-------------------111111-11111111111111111-----------------2--------------1---------------------------11111111111-1 --------------2----------------------------------------------------------------------------------------122---156722A1212124-22-A2372-2522-1-43121-1-1-4--4-2133---4-32-1-13--711--------21----1-1------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 166 STR:RPRED 100.0 SQ:SECSTR cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTcHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcHHHHHHTHHHHHHHHHHHHHHHHHHHHHHHHccTTHHHHHHHHHHHHHHHHcc PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccccc //