[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : galE
DDBJ      :galE         UDP-glucose 4-epimerase
Swiss-Prot:             

Homologs  Archaea  65/68 : Bacteria  819/915 : Eukaryota  190/199 : Viruses  2/175   --->[See Alignment]
c.2.1
:339 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->331 1lrkA PDBj e-103 55.4 %
:RPS:PDB   3->332 1ek6B PDBj 1e-45 54.7 %
:RPS:SCOP  2->330 1sb8A  c.2.1.2 * 1e-69 27.4 %
:HMM:SCOP  1->332 1gy8A_ c.2.1.2 * 9.5e-94 37.6 %
:RPS:PFM   5->249 PF01370 * Epimerase 1e-37 43.9 %
:HMM:PFM   5->264 PF01370 * Epimerase 2.6e-60 35.7 238/238  
:HMM:PFM   274->336 PF06018 * CodY 0.00023 30.2 63/177  
:BLT:SWISS 5->331 GALE_BACSU e-119 63.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30956.1 GT:GENE galE GT:PRODUCT UDP-glucose 4-epimerase GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1125677..1126696) GB:FROM 1125677 GB:TO 1126696 GB:DIRECTION - GB:GENE galE GB:PRODUCT UDP-glucose 4-epimerase GB:PROTEIN_ID ACD30956.1 GB:DB_XREF GI:187712659 GB:GENE:GENE galE LENGTH 339 SQ:AASEQ MNKKILVTGGVGYIGSHTVVELLDRDYQVVVVDNLSNSKVSVIDRVKKITNKDFDFYQLDLLGKAKLTKVFQEHDIYAVIHFAGFKAVGESVEKPLEYYHNNIQGTLNLLELMQEYKVYNFVFSSSATVYGMNNKPPFTEDMPLSTTNPYGATKLMLEDILRDLQNANNNFNITCLRYFNPVGAHSSGMIGEDPQGIPNNLMPYVAQVGAGKLAKLSIFGGDYETIDGTGVRDYIHVVDLAIGHILALEKLSQDKPSWRAYNLGSGNGYSVLEIVKAYQKALGKEIPYQIVARRAGDIAASFADVAKAKRELGFETQKTIDDICDDMLKWQKYAKENNI GT:EXON 1|1-339:0| BL:SWS:NREP 1 BL:SWS:REP 5->331|GALE_BACSU|e-119|63.5|326/339| BL:PDB:NREP 1 BL:PDB:REP 4->331|1lrkA|e-103|55.4|327/338| RP:PDB:NREP 1 RP:PDB:REP 3->332|1ek6B|1e-45|54.7|329/345| RP:PFM:NREP 1 RP:PFM:REP 5->249|PF01370|1e-37|43.9|221/232|Epimerase| HM:PFM:NREP 2 HM:PFM:REP 5->264|PF01370|2.6e-60|35.7|238/238|Epimerase| HM:PFM:REP 274->336|PF06018|0.00023|30.2|63/177|CodY| GO:PFM:NREP 3 GO:PFM GO:0003824|"GO:catalytic activity"|PF01370|IPR001509| GO:PFM GO:0044237|"GO:cellular metabolic process"|PF01370|IPR001509| GO:PFM GO:0050662|"GO:coenzyme binding"|PF01370|IPR001509| RP:SCP:NREP 1 RP:SCP:REP 2->330|1sb8A|1e-69|27.4|310/341|c.2.1.2| HM:SCP:REP 1->332|1gy8A_|9.5e-94|37.6|330/383|c.2.1.2|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 3793 OP:NHOMOORG 1076 OP:PATTERN 112-1-21344335312512113373345532354225141224636748664133322431122-12 7663B22333511113422-21223222222221212324378813111333443211114111554747213332222112736854A78424221--54556457766--------------33344395354668888-118386475552222533232234455855344344564463231143413544545884457578636555445A35223531112116A2111111111111113---141113222313341122242122211232122232233323223223111111-11--11232332222232-646665666545624444426182-53242459655343212122423674445-----44A545433644732223233314-54595765273265529C57B99853423234776744-4444444443434563-------------------------1-2-2243312553234433423333337533332334523321123271233223522333623233225545333453423566399446667576545594443545766444314335532421222123123354656433443142355533333233532234--15333------25435443443333343-4532344433432223322533224443254535333353542534233334-522222222222--2-333331111335342212221211122225222214234533233356123445265523332233334346222222413435333332222222--66556677111111113-2----------1-1---13-1-----1133521221463 --11223-211146621342342343211211111111111111113322445523323233322-2112112121111122222233-12211212122131335-4A4425343422-214252162FC5-4542231413431222-4114244458A937232122N44737345*A7644PIMN3L86876565 -----------------------1--------------------------------------------------------------------------------------------------------------------------------------------------1---- STR:NPRED 338 STR:RPRED 99.7 SQ:SECSTR HTcEEEEETTTcHHHHHHHHHHHHTTcEEEEEEccTTcccccccHHHHHHccccEEEEccTTcHHHHHHHHHHccEEEEEEccccccHHHHHHcHHHHHHHHHHHHHHHHHHHHHHTccEEEEEEEGGGGcccccccccTTcccccccHHHHHHHHHHHHHHHHHHHcTTcEEEEEEEcEEEcccTTcccccccccccccHHHHHHHHHTTccccEEEEcccccccccccEEEEEEHHHHHHHHHHHHHHHHTTccEEEEEEEccccEEEHHHHHHHHHHHHcccccEEEEcccTTcccEEccccHHHHHHHcccccccHHHHHHHHHHHHHHHTTcc# DISOP:02AL 339-340| PSIPRED cccEEEEEccccHHHHHHHHHHHHcccEEEEEEccccccHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEcHHEEccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccEEEEEEcccccccccccccccccccHHHHHHHHHHHHccccccEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHccccccEEEEEccccEEEHHHHHHHHHHHHcccccEEEccccccccccccccHHHHHHHHcccccccHHHHHHHHHHHHHHcHHccc //