[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : galK
DDBJ      :galK         galactokinase
Swiss-Prot:             

Homologs  Archaea  11/68 : Bacteria  337/915 : Eukaryota  169/199 : Viruses  0/175   --->[See Alignment]
d.14.1d.58.26
:382 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->382 1pieA PDBj 1e-58 36.9 %
:RPS:PDB   8->382 2a2cA PDBj 4e-70 27.4 %
:RPS:SCOP  13->201 1wuuA1  d.14.1.5 * 3e-52 31.2 %
:RPS:SCOP  205->378 1s4eA2  d.58.26.7 * 4e-38 33.7 %
:HMM:SCOP  2->204 1wuuA1 d.14.1.5 * 7.4e-57 36.5 %
:HMM:SCOP  205->382 1pieA2 d.58.26.7 * 1.3e-54 39.9 %
:RPS:PFM   13->60 PF10509 * GalKase_gal_bdg 1e-13 60.4 %
:RPS:PFM   115->180 PF00288 * GHMP_kinases_N 7e-04 35.4 %
:RPS:PFM   287->345 PF08544 * GHMP_kinases_C 5e-06 48.2 %
:HMM:PFM   11->60 PF10509 * GalKase_gal_bdg 6.3e-26 60.0 50/52  
:HMM:PFM   114->180 PF00288 * GHMP_kinases_N 2.6e-17 37.9 66/68  
:HMM:PFM   281->347 PF08544 * GHMP_kinases_C 4.1e-14 28.1 64/82  
:BLT:SWISS 10->368 GAL1_THETN 1e-72 38.8 %
:PROS 28->39|PS00106|GALACTOKINASE
:PROS 121->132|PS00627|GHMP_KINASES_ATP
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30712.1 GT:GENE galK GT:PRODUCT galactokinase GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(799958..801106) GB:FROM 799958 GB:TO 801106 GB:DIRECTION - GB:GENE galK GB:PRODUCT galactokinase GB:PROTEIN_ID ACD30712.1 GB:DB_XREF GI:187712415 GB:GENE:GENE galK LENGTH 382 SQ:AASEQ MMDCIKHNLINRFVELYGRKPQLFFSPGRVNLIGEHTDYNNGFVMPFAINKGTFIAIAKRDDNIVNVYSENLDDSSSFDITKIKQEISNTWQNYIKGVINIINQDFSSDIKGADIYIFSDLPFGAGLSSSSSLNTALAYAYNDIYQLNISKIDVAKIAQKVEHEYIGTKCGLMDQMACLFSQQNAATMIDCNDNHYDNIPFELDNLSVLICDTNIKHNLADSAYNKRRQVCENIARFHSIKSLRELDSQKLEDTKLNFSEEDHKLALHVFTENQRVIEATKAMVAKDWQKLGKLMYQSHNSLKNDYKVSCDELDYLVELSQNFAGIYGARMTGGGFGGSTIHLLPTKLLKEYASYLEKNYFEKFNIKPSFYISKACQGTCKL GT:EXON 1|1-382:0| BL:SWS:NREP 1 BL:SWS:REP 10->368|GAL1_THETN|1e-72|38.8|358/390| PROS 28->39|PS00106|GALACTOKINASE|PDOC00099| PROS 121->132|PS00627|GHMP_KINASES_ATP|PDOC00545| SEG 127->133|lsssssl| BL:PDB:NREP 1 BL:PDB:REP 9->382|1pieA|1e-58|36.9|374/388| RP:PDB:NREP 1 RP:PDB:REP 8->382|2a2cA|4e-70|27.4|368/446| RP:PFM:NREP 3 RP:PFM:REP 13->60|PF10509|1e-13|60.4|48/52|GalKase_gal_bdg| RP:PFM:REP 115->180|PF00288|7e-04|35.4|65/68|GHMP_kinases_N| RP:PFM:REP 287->345|PF08544|5e-06|48.2|56/82|GHMP_kinases_C| HM:PFM:NREP 3 HM:PFM:REP 11->60|PF10509|6.3e-26|60.0|50/52|GalKase_gal_bdg| HM:PFM:REP 114->180|PF00288|2.6e-17|37.9|66/68|GHMP_kinases_N| HM:PFM:REP 281->347|PF08544|4.1e-14|28.1|64/82|GHMP_kinases_C| GO:PFM:NREP 3 GO:PFM GO:0005524|"GO:ATP binding"|PF00288|IPR006204| GO:PFM GO:0016301|"GO:kinase activity"|PF00288|IPR006204| GO:PFM GO:0016310|"GO:phosphorylation"|PF00288|IPR006204| RP:SCP:NREP 2 RP:SCP:REP 13->201|1wuuA1|3e-52|31.2|186/215|d.14.1.5| RP:SCP:REP 205->378|1s4eA2|4e-38|33.7|169/171|d.58.26.7| HM:SCP:REP 2->204|1wuuA1|7.4e-57|36.5|200/0|d.14.1.5|1/1|Ribosomal protein S5 domain 2-like| HM:SCP:REP 205->382|1pieA2|1.3e-54|39.9|178/183|d.58.26.7|1/1|GHMP Kinase, C-terminal domain| OP:NHOMO 667 OP:NHOMOORG 517 OP:PATTERN --1-1-----------11--1--------1-------------------------11-111------- 111-1-1----11-11111-1---11111111----11111111111-111-1111-1----11111111-11111111---------1111-111----11-1-111-1--------------------------11111---1----1-------------------1-------------11-111111-2-------1-------111111---111--1--------2---------------1---1111-11-1111111112112131111----11111111111111111-------------111111111-1--11----------1----11111----11--------1---1111-11-----------------------------------------------1--------------------------------------------------------------------------11-----------------------------------------1----------------------------1-------------1----1-1-----------1-----------------------------1211-1--1111121211111112122113-------------11111111111111111-11-1111111111--11-1111111111111111111111111111111111-111111111111------------------111111-11111-11-----------1-----------------111111111--1111111111-11-----------------2111-11--------31--------------------------1111111111-11 ----112-21--11111111111111111111111111111111111111111111111111111-11---21-122-2211111111----1-111-1-1-1111-23-44222312-22122332425A3-433122152222-22-122142322223322222333-11321--1H1111143431221112521 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 382 STR:RPRED 100.0 SQ:SECSTR HHHHHHHHHHHHHHHHHcccccEEEEEEEEEEEcTTcGGGTcccEEEEEEEEEEEEEEEcccccEEEEEccTTcccEEEcccccccccccHHHHHHHHHHHHHHHTccccccEEEEEEEcccTTccccHHHHHHHHHHHHHHHHHTccccHHHHHHHHHHHHGHGGTcccccHHHHHHHHccTTcEEEEETTTTEEEEEcccTTEEEEEEEEcccccGGGccHHHHHHHHHHHHHHHHHHTTccTTTcccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccTTHHHHHHHHHHHHHHHHHHTcccccHHHHHHHHHHHHHTTccEEEEcTTccccEEEEEEEGGGHHHHHHHHHHHHHcHccccccEEEEccccccEEE DISOP:02AL 382-383| PSIPRED cHHHHHHHHHHHHHHHHccccEEEEEcEEEEEEcccEEEcccEEEEEEEccEEEEEEEEccccEEEEEEccccccEEEEcccccccccccHHHHHHHHHHHHHHHcccccccEEEEEEccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccHHHHHHHHHccccEEEEEEcccccEEEEEccccccEEEEEEcccccccccccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccEEEEccccccccEEEEEEcHHHHHHHHHHHHHHHHHHcccccEEEEEEcccccEEc //