[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : gatA
DDBJ      :gatA         glutamyl-tRNA(Gln)/aspartyl-tRNA(Asn) amidotransferase, A subunit
Swiss-Prot:GATA_FRATM   RecName: Full=Glutamyl-tRNA(Gln) amidotransferase subunit A;         Short=Glu-ADT subunit A;         EC=6.3.5.-;

Homologs  Archaea  52/68 : Bacteria  778/915 : Eukaryota  187/199 : Viruses  0/175   --->[See Alignment]
c.117.1
:481 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   14->469 3h0lA PDBj e-108 46.6 %
:RPS:PDB   4->470 2dqnA PDBj e-128 39.6 %
:RPS:SCOP  4->470 2df4A1  c.117.1.1 * e-128 39.6 %
:HMM:SCOP  3->470 1mt5A_ c.117.1.1 * 2.9e-137 42.3 %
:RPS:PFM   21->458 PF01425 * Amidase 1e-81 41.5 %
:HMM:PFM   20->458 PF01425 * Amidase 3.9e-141 41.6 423/435  
:BLT:SWISS 1->481 GATA_FRATM 0.0 100.0 %
:PROS 147->178|PS00571|AMIDASES
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30185.1 GT:GENE gatA GT:PRODUCT glutamyl-tRNA(Gln)/aspartyl-tRNA(Asn) amidotransferase, A subunit GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 90007..91452 GB:FROM 90007 GB:TO 91452 GB:DIRECTION + GB:GENE gatA GB:PRODUCT glutamyl-tRNA(Gln)/aspartyl-tRNA(Asn) amidotransferase, A subunit GB:PROTEIN_ID ACD30185.1 GB:DB_XREF GI:187711888 GB:GENE:GENE gatA LENGTH 481 SQ:AASEQ MSYIKKLRARLDSGEISAVELTKEYLAKIKEQDKRINSVITLCEAEALKEAEDADAIISAGKQGLLTGIPILHKDLFCTKGIRTTAASKMLDNFVAPYDSTVTKNCKDQGMVTLGKLNMDEFAMGSTNEYSYYGAVSNPWDLERVPGGSSGGSAAAVAAGFAPISTGSDTGGSVRQPASFCGLTAMKPSYGSTSRFGMVAFASSFDQAGIFGHYAEDVALMLDAIAGECEFDSTCVGVKQNHFTQDLEKDISGKVIGVDESLIKDLPAQIQEAVSKTLDNFKKLGAEIKSVKVPDLKEALSTYYIITPAEAAANLARYDGIRYGYRNPEARDLDELYRKSRTDGFGAEVKRRIMIGNYVLASSQYDSYYNKSQQLRKVMTDQINQIFTQVDAIFMPASPSEAFKKGDKLDPVSAYLSDIYTIPANISGLPAIAFPIGFANNLPVGGQLMAKAFNDNILTQMVVQYQKHYGIEEFILQQARI GT:EXON 1|1-481:0| SW:ID GATA_FRATM SW:DE RecName: Full=Glutamyl-tRNA(Gln) amidotransferase subunit A; Short=Glu-ADT subunit A; EC=6.3.5.-; SW:GN Name=gatA; OrderedLocusNames=FTM_0084; SW:KW ATP-binding; Complete proteome; Ligase; Nucleotide-binding;Protein biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->481|GATA_FRATM|0.0|100.0|481/481| GO:SWS:NREP 4 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0016874|"GO:ligase activity"|Ligase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006412|"GO:translation"|Protein biosynthesis| PROS 147->178|PS00571|AMIDASES|PDOC00494| SEG 44->56|eaealkeaedada| SEG 147->160|ggssggsaaavaag| BL:PDB:NREP 1 BL:PDB:REP 14->469|3h0lA|e-108|46.6|451/478| RP:PDB:NREP 1 RP:PDB:REP 4->470|2dqnA|e-128|39.6|467/485| RP:PFM:NREP 1 RP:PFM:REP 21->458|PF01425|1e-81|41.5|417/425|Amidase| HM:PFM:NREP 1 HM:PFM:REP 20->458|PF01425|3.9e-141|41.6|423/435|Amidase| GO:PFM:NREP 1 GO:PFM GO:0016884|"GO:carbon-nitrogen ligase activity, with glutamine as amido-N-donor"|PF01425|IPR000120| RP:SCP:NREP 1 RP:SCP:REP 4->470|2df4A1|e-128|39.6|467/485|c.117.1.1| HM:SCP:REP 3->470|1mt5A_|2.9e-137|42.3|456/537|c.117.1.1|1/1|Amidase signature (AS) enzymes| OP:NHOMO 2876 OP:NHOMOORG 1017 OP:PATTERN 11-1--2433333332--111112211111231111111111111111111111-----------111 36C3311311211273466-63229D66666747775CB923232231134153322111344216A24231111111-111511111--------1------1-2113111111111-11111111111111111433331111523222232211111211121334531211111211114232211151133333233133333331322133322123122222112711111111111111111111411122121111122111111121113332222122111111111112222222222222122111222311-2111111111112-111---11211111112211111211111111171164471111121IJJ214C49D24455454233416686355B5981944953556543I81723454344346545555556442222211111122111111111111111111111234A119BC99B6A9AC4777777FB77784A88D6BF7142323543363A3B6431111111111111111214424241122111111111111112144335722111111111111111111111211122112232-131311111-111111-11-1-2-111232------1133--2---1-11----------------------112111-1-----------------4----------11111111111----11111333325427---------------444441212213435328373354318571111111112--------------1132222-------11111111221111111111-----1-11111111111111111111112112111221 11--221-2-1---279D557866A675656655556747467434347BA9EE4674455542322332222243223322222222-57493222234312222-233H231131111-221331424E3-2361111321422312121111453136-27332623965611213O24337C89H9691122221 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 470 STR:RPRED 97.7 SQ:SECSTR ###HHHHHHHHHTTcccHHHHHHHHHHHHHHHHHHHccEEEEcHHHHHHHHHHHHHHHHTTccccccccEEEEETTcccTTccccTTcGGGTTcccccccHHHHHHHHTTcEEEEEEcccGGGcccccTTccccccccTTcTTcccccccHHHHHHHHTTcccEEEEEccccTTHHHHHHHTcEEEEccTTccccTTcccccTTTccEEEEEccHHHHHHHHHHHccccTTcTTccccccccccTTTTcccTTcEEEEGGGGcTTccHHHHHHHHHHHHHHHHTTcEEEEEccGGGGGHHHHHHHHHHHHHHHHTTTcccccccccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHcTTTHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEccccccccTTTcTcHHHHHHTTTTTHHHHHHTccEEEEEEEEETTEEEEEEEEccTTcHHHHHHHHHHHHHHcccTT######## DISOP:02AL 481-482| PSIPRED cccHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccEEEEEcHHHHHHHHHHHHHHHHccccccccccEEHHHHHHHccccccccHHHHHccccccccHHHHHHHHHcccEEEEEEcccHHcccccccccccccccccccccccccccccHHHHHHHcccccEEEEEccccccccccHHcccEEEccccccccccccccccccccEEEEEcccHHHHHHHHHHHcccccccccccccccccHHHHcccccccEEEEEEccccccccHHHHHHHHHHHHHHHHcccEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEcccccccccccccccHHHHHHHHHHHHHHHHHcccEEEEEccccccEEEEEEEEcccccHHHHHHHHHHHHHHHcccHHccccccc //