[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : gatC
DDBJ      :gatC         glutamyl-tRNA(Gln) amidotransferase, C subunit
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  16/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.137.12
:93 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   25->92 3h0lC PDBj 7e-05 32.8 %
:RPS:PDB   2->92 2dqnC PDBj 3e-20 25.3 %
:RPS:SCOP  1->92 2df4C1  a.137.12.1 * 2e-20 25.0 %
:HMM:SCOP  1->91 2f2aC1 a.137.12.1 * 8.7e-22 33.0 %
:HMM:PFM   17->88 PF02686 * Glu-tRNAGln 1.7e-17 33.3 72/72  
:BLT:SWISS 1->93 GATC_VESOH 7e-13 31.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30184.1 GT:GENE gatC GT:PRODUCT glutamyl-tRNA(Gln) amidotransferase, C subunit GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 89717..89998 GB:FROM 89717 GB:TO 89998 GB:DIRECTION + GB:GENE gatC GB:PRODUCT glutamyl-tRNA(Gln) amidotransferase, C subunit GB:PROTEIN_ID ACD30184.1 GB:DB_XREF GI:187711887 GB:GENE:GENE gatC LENGTH 93 SQ:AASEQ MDKKLVKHIAKLSCFDLTEEQLEQYTKDLINICKILDTVKNFDAQGVKPMISPISVDFKFREDIPQDQDNRTSFDKFACEVVDDYFMVPQVVK GT:EXON 1|1-93:0| BL:SWS:NREP 1 BL:SWS:REP 1->93|GATC_VESOH|7e-13|31.2|93/95| BL:PDB:NREP 1 BL:PDB:REP 25->92|3h0lC|7e-05|32.8|67/91| RP:PDB:NREP 1 RP:PDB:REP 2->92|2dqnC|3e-20|25.3|91/98| HM:PFM:NREP 1 HM:PFM:REP 17->88|PF02686|1.7e-17|33.3|72/72|Glu-tRNAGln| RP:SCP:NREP 1 RP:SCP:REP 1->92|2df4C1|2e-20|25.0|92/99|a.137.12.1| HM:SCP:REP 1->91|2f2aC1|8.7e-22|33.0|91/0|a.137.12.1|1/1|Glu-tRNAGln amidotransferase C subunit| OP:NHOMO 16 OP:NHOMOORG 16 OP:PATTERN -------------------------------------------------------------------- --------111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------11-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111------------------------------1--------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 91 STR:RPRED 97.8 SQ:SECSTR #cHHHHHHHHHHHTccccHHHHHHHHHHHHHHHHHHGGGGGcccTTccccccccccccccccccccccccHHHHHTTccccccccccccccc# DISOP:02AL 92-94| PSIPRED ccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHcHHHcccEEEcccccc //