[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : gcvH
DDBJ      :gcvH         glycine cleavage system H protein (lipoate-binding)
Swiss-Prot:             

Homologs  Archaea  32/68 : Bacteria  681/915 : Eukaryota  177/199 : Viruses  0/175   --->[See Alignment]
b.84.1
:127 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->127 1dxmA PDBj 5e-32 49.2 %
:RPS:PDB   2->126 1dxmA PDBj 6e-19 49.6 %
:RPS:SCOP  2->126 1dxmA  b.84.1.1 * 3e-19 49.6 %
:HMM:SCOP  3->129 1onlA_ b.84.1.1 * 9.4e-47 56.7 %
:RPS:PFM   8->127 PF01597 * GCV_H 3e-30 59.2 %
:HMM:PFM   8->126 PF01597 * GCV_H 4.5e-48 57.1 119/122  
:BLT:SWISS 1->127 GCSH_ECO7I 3e-43 61.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30565.1 GT:GENE gcvH GT:PRODUCT glycine cleavage system H protein (lipoate-binding) GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 616821..617204 GB:FROM 616821 GB:TO 617204 GB:DIRECTION + GB:GENE gcvH GB:PRODUCT glycine cleavage system H protein (lipoate-binding) GB:PROTEIN_ID ACD30565.1 GB:DB_XREF GI:187712268 GB:GENE:GENE gcvH LENGTH 127 SQ:AASEQ MSNIPKELKYTKSHEWVKIDGDEVTVGITAHAQSLLGDLVYVELPEIGEEFAAGDDSCVVESVKAASDVYAPVDGEVIEINEALVDDPSRVNHTPYKDGWLFKLKISDESQLADLLTADAYAKTLED GT:EXON 1|1-127:0| BL:SWS:NREP 1 BL:SWS:REP 1->127|GCSH_ECO7I|3e-43|61.4|127/129| BL:PDB:NREP 1 BL:PDB:REP 2->127|1dxmA|5e-32|49.2|126/131| RP:PDB:NREP 1 RP:PDB:REP 2->126|1dxmA|6e-19|49.6|125/131| RP:PFM:NREP 1 RP:PFM:REP 8->127|PF01597|3e-30|59.2|120/121|GCV_H| HM:PFM:NREP 1 HM:PFM:REP 8->126|PF01597|4.5e-48|57.1|119/122|GCV_H| GO:PFM:NREP 3 GO:PFM GO:0005739|"GO:mitochondrion"|PF01597|IPR002930| GO:PFM GO:0005960|"GO:glycine cleavage complex"|PF01597|IPR002930| GO:PFM GO:0006546|"GO:glycine catabolic process"|PF01597|IPR002930| RP:SCP:NREP 1 RP:SCP:REP 2->126|1dxmA|3e-19|49.6|125/131|b.84.1.1| HM:SCP:REP 3->129|1onlA_|9.4e-47|56.7|127/0|b.84.1.1|1/1|Single hybrid motif| OP:NHOMO 1097 OP:NHOMOORG 890 OP:PATTERN 111-113332323333--------1111--11----------------------11111111111--- 132311-----11111111-1111211111121111112311111111-11-32211211111221311111111111----1531111111-111---113111111111111111111111111111111112111111---1411111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111-1-11-------1111------------------------------------------------------21--1111111-1--111----1---11----31-4-11113112-1--112111111111111111111111111111111111-1111111-211-1111111-1111111111111111112111111111111-111-----------------------------11111-1111111111111111111111111111111111111111111111111--111111111111111111112-1-1111412111-2222222123413111--------------------------3311-111211111111111111111111111--11113------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111---111111111111211---------------1111111111112322222222322222222222222211112111111111111111111111111111-111111--------1-1-------------------------1111111111111 11--341-311-111111111111111111111111111111111111112222--1--1--11111111111111111111111111-11111111111111112-121321322111321111213-1A2-1121-111--91-11-11113131121-111112112-22111111I111112474131112111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 127 STR:RPRED 100.0 SQ:SECSTR cccccTTcEEcTTcEEEEEETTEEEEEEcHHHHHHHccEEEEEcccTTcEEcTTcEEEEEEEcccEEEEEccccEEEEEEcTHHHHcTTHHHHcTTTTTccEEEEEccGGGGGccccHHHHHHHHHH PSIPRED cccccHHccccccEEEEEEEccEEEEEEcHHHHHHcccEEEEEEcccccEEcccccEEEEEEEcEEEccccccccEEEEEEHHHHHcHHHHHcccccccEEEEEEEccHHHHHHcccHHHHHHHHcc //