[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : gpsA
DDBJ      :gpsA         glycerol-3-phosphate dehydrogenase [NAD(P)+] (NAD(P)H-dependent glycerol-3-phosphate dehydrogenase)
Swiss-Prot:GPDA_FRATM   RecName: Full=Glycerol-3-phosphate dehydrogenase [NAD(P)+];         EC=1.1.1.94;AltName: Full=NAD(P)H-dependent glycerol-3-phosphate dehydrogenase;

Homologs  Archaea  4/68 : Bacteria  860/915 : Eukaryota  171/199 : Viruses  0/175   --->[See Alignment]
a.100.1c.143.1c.2.1
:332 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   42->70 2ivxB PDBj 7e-04 48.3 %
:BLT:PDB   88->331 1n1eA PDBj 2e-46 42.3 %
:RPS:PDB   24->313 3egoB PDBj 1e-30 9.8 %
:RPS:SCOP  23->200 2hzbA1  c.143.1.1 * 2e-20 8.2 %
:RPS:SCOP  180->325 1txgA1  a.100.1.6 * 1e-51 39.6 %
:HMM:SCOP  3->179 1txgA2 c.2.1.6 * 6e-47 44.3 %
:HMM:SCOP  179->331 1evyA1 a.100.1.6 * 2.3e-57 58.8 %
:RPS:PFM   25->157 PF01210 * NAD_Gly3P_dh_N 7e-20 40.2 %
:RPS:PFM   180->323 PF07479 * NAD_Gly3P_dh_C 1e-41 54.9 %
:HMM:PFM   179->323 PF07479 * NAD_Gly3P_dh_C 4.8e-49 49.7 145/149  
:HMM:PFM   4->161 PF01210 * NAD_Gly3P_dh_N 1.8e-42 40.8 157/159  
:BLT:SWISS 1->332 GPDA_FRATM e-179 100.0 %
:PROS 188->209|PS00957|NAD_G3PDH
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30481.1 GT:GENE gpsA GT:PRODUCT glycerol-3-phosphate dehydrogenase [NAD(P)+] (NAD(P)H-dependent glycerol-3-phosphate dehydrogenase) GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 505334..506332 GB:FROM 505334 GB:TO 506332 GB:DIRECTION + GB:GENE gpsA GB:PRODUCT glycerol-3-phosphate dehydrogenase [NAD(P)+] (NAD(P)H-dependent glycerol-3-phosphate dehydrogenase) GB:PROTEIN_ID ACD30481.1 GB:DB_XREF GI:187712184 GB:GENE:GENE gpsA LENGTH 332 SQ:AASEQ MQKNILVLGAGAWGTALALQLAYRGHNVRINSWKAEHNEQMLEDNNNHKYLPSIEKFPSRLKAIQDWQANIIEFDSILVATPSSGFKNTVLELKECILPQQNIISATKGFCHDSYALLSEIAEDILPTTKFALLTGPSFAKELANQLPTAVVVASKDINYARYVQELFSNENFRCYTTTDIIGAQVGGAVKNVLAITAGIAAGMEFGVNAHAALITRGLAEIKKLGLKLGANSETFIGLSCLGDLLLTCSDNQSRNRRFGLYLGQGMTIQQALKEVNNVVEGYFTAKAVYNLAKKHNVEMPLVFATYRILYEAADPRDIVKELMTRQLKNEN GT:EXON 1|1-332:0| SW:ID GPDA_FRATM SW:DE RecName: Full=Glycerol-3-phosphate dehydrogenase [NAD(P)+]; EC=1.1.1.94;AltName: Full=NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; SW:GN Name=gpsA; OrderedLocusNames=FTM_0460; SW:KW Complete proteome; Cytoplasm; NAD; Oxidoreductase;Phospholipid biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->332|GPDA_FRATM|e-179|100.0|332/332| GO:SWS:NREP 4 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0008654|"GO:phospholipid biosynthetic process"|Phospholipid biosynthesis| PROS 188->209|PS00957|NAD_G3PDH|PDOC00740| SEG 6->22|lvlgagawgtalalqla| BL:PDB:NREP 2 BL:PDB:REP 42->70|2ivxB|7e-04|48.3|29/255| BL:PDB:REP 88->331|1n1eA|2e-46|42.3|241/349| RP:PDB:NREP 1 RP:PDB:REP 24->313|3egoB|1e-30|9.8|266/291| RP:PFM:NREP 2 RP:PFM:REP 25->157|PF01210|7e-20|40.2|132/159|NAD_Gly3P_dh_N| RP:PFM:REP 180->323|PF07479|1e-41|54.9|144/145|NAD_Gly3P_dh_C| HM:PFM:NREP 2 HM:PFM:REP 179->323|PF07479|4.8e-49|49.7|145/149|NAD_Gly3P_dh_C| HM:PFM:REP 4->161|PF01210|1.8e-42|40.8|157/159|NAD_Gly3P_dh_N| GO:PFM:NREP 8 GO:PFM GO:0005737|"GO:cytoplasm"|PF01210|IPR011128| GO:PFM GO:0016616|"GO:oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor"|PF01210|IPR011128| GO:PFM GO:0046168|"GO:glycerol-3-phosphate catabolic process"|PF01210|IPR011128| GO:PFM GO:0051287|"GO:NAD or NADH binding"|PF01210|IPR011128| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01210|IPR011128| GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF07479|IPR006109| GO:PFM GO:0016614|"GO:oxidoreductase activity, acting on CH-OH group of donors"|PF07479|IPR006109| GO:PFM GO:0055114|"GO:oxidation reduction"|PF07479|IPR006109| RP:SCP:NREP 2 RP:SCP:REP 23->200|2hzbA1|2e-20|8.2|171/311|c.143.1.1| RP:SCP:REP 180->325|1txgA1|1e-51|39.6|144/155|a.100.1.6| HM:SCP:REP 3->179|1txgA2|6e-47|44.3|174/0|c.2.1.6|1/1|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 179->331|1evyA1|2.3e-57|58.8|153/160|a.100.1.6|1/1|6-phosphogluconate dehydrogenase C-terminal domain-like| OP:NHOMO 1226 OP:NHOMOORG 1035 OP:PATTERN -----------------------1--------1-1-----------1--------------------- 111-111111121121222-22112222222222221222111111211111111111111111111111111111111111-11111111111111--1111111112111111111111111111111111111-----1111-11111111111-----111111111------------11111111111111111111111111111111111111111111111111111111111111111121111112112111111111111111111111111111111111111111111111111111111111111111-111111111111111111-11121111111111111111111111--1111-111111111111111111111111111111111-11111111111111111111111111111211111111111111111111111111111111111111111-111-1111111111112111111111111111111111111111111111111111111111111111111111111111111111111-111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111-11111------11111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111113333331111111111111111-111-11----111-111111111111-11111 2211----411-22111111111222211111111111-1-1111111111111-1------122111-22221212-2212222222-111112132212-13351231235334311--22-3412-2921112--1122122-11-12111123341312121-424135312531722232322212-2243321 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 308 STR:RPRED 92.8 SQ:SECSTR #######################TTcEEEEEcccHHHHHHHHHHcEEEEETTEEEEccccEEccEEEccccccccEEEEcccGGGHHHHHHHHHTccccEEEEcccccHHHHHHHTcccccEEEEEEEccEEEEccccEEEEEEcccEEEEEcTTccTHGHHHHHHccccTTccEEEcccHHHHHHHHHHHHHHHHHHHHHHTccTTHHHHHHHHHHHHHHHHHHHTcccHHHHHHHHHHHHHHTTTcccHHHHHHTTTcTTccccEEEETTEEEEcccccHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHTTcccccTTccccTTGGG# PSIPRED cccEEEEEcccHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHcccccccccccccccccEEEEccHHHHHccccEEEEEccHHHHHHHHHHHHHHcccccEEEEEEccccccccccHHHHHHHHcccccEEEEEcccHHHHHHcccccEEEEEcccHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHccccHHHHHHHHcccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccHHHHHHHHHcccccccc //