[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : grpE
DDBJ      :grpE         chaperone GrpE (heat shock protein). Hsp70/Hsc70 protein regulator activity
Swiss-Prot:GRPE_FRATM   RecName: Full=Protein grpE;AltName: Full=HSP-70 cofactor;

Homologs  Archaea  24/68 : Bacteria  842/915 : Eukaryota  190/199 : Viruses  0/175   --->[See Alignment]
b.73.1d.58.61h.1.9
:195 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   38->194 1dkgA PDBj 1e-31 42.8 %
:RPS:PDB   41->194 1dkgB PDBj 4e-39 42.6 %
:RPS:SCOP  71->144 2raqA1  d.58.61.1 * 4e-11 16.4 %
:RPS:SCOP  139->194 1dkgA1  b.73.1.1 * 1e-19 39.3 %
:HMM:SCOP  39->138 1dkgB2 h.1.9.1 * 7e-25 45.0 %
:HMM:SCOP  139->197 1dkgA1 b.73.1.1 * 4.9e-18 49.2 %
:RPS:PFM   34->190 PF01025 * GrpE 1e-26 49.0 %
:HMM:PFM   37->194 PF01025 * GrpE 1.1e-56 46.2 158/166  
:BLT:SWISS 1->195 GRPE_FRATM e-107 100.0 %
:PROS 149->192|PS01071|GRPE
:COIL

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30967.1 GT:GENE grpE GT:PRODUCT chaperone GrpE (heat shock protein). Hsp70/Hsc70 protein regulator activity GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1141245..1141832) GB:FROM 1141245 GB:TO 1141832 GB:DIRECTION - GB:GENE grpE GB:PRODUCT chaperone GrpE (heat shock protein). Hsp70/Hsc70 protein regulator activity GB:PROTEIN_ID ACD30967.1 GB:DB_XREF GI:187712670 GB:GENE:GENE grpE LENGTH 195 SQ:AASEQ MSKQEKSNVEDKSLDIETAVQVETAQESASGALEELSVEEQLERAKDTIKELEDSCDQFKDEALRAKAEMENIRKRAERDVSNARKFGIEKFAKELLPVIDSIGQALKHEVKHEEAIAMKEGIELTAKMLVDILKKNGVEELDPKGEKFDPNLHEAMAMIPNPEFEDNTIFDVFQKGYMLNGRIVRAAKVVIVKN GT:EXON 1|1-195:0| SW:ID GRPE_FRATM SW:DE RecName: Full=Protein grpE;AltName: Full=HSP-70 cofactor; SW:GN Name=grpE; OrderedLocusNames=FTM_1062; SW:KW Chaperone; Complete proteome; Cytoplasm; Stress response. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->195|GRPE_FRATM|e-107|100.0|195/195| GO:SWS:NREP 2 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0006950|"GO:response to stress"|Stress response| PROS 149->192|PS01071|GRPE|PDOC00822| COIL:NAA 47 COIL:NSEG 1 COIL:REGION 33->79| BL:PDB:NREP 1 BL:PDB:REP 38->194|1dkgA|1e-31|42.8|152/158| RP:PDB:NREP 1 RP:PDB:REP 41->194|1dkgB|4e-39|42.6|148/151| RP:PFM:NREP 1 RP:PFM:REP 34->190|PF01025|1e-26|49.0|157/180|GrpE| HM:PFM:NREP 1 HM:PFM:REP 37->194|PF01025|1.1e-56|46.2|158/166|GrpE| GO:PFM:NREP 6 GO:PFM GO:0000774|"GO:adenyl-nucleotide exchange factor activity"|PF01025|IPR000740| GO:PFM GO:0005739|"GO:mitochondrion"|PF01025|IPR000740| GO:PFM GO:0006457|"GO:protein folding"|PF01025|IPR000740| GO:PFM GO:0030150|"GO:protein import into mitochondrial matrix"|PF01025|IPR000740| GO:PFM GO:0042803|"GO:protein homodimerization activity"|PF01025|IPR000740| GO:PFM GO:0051087|"GO:chaperone binding"|PF01025|IPR000740| RP:SCP:NREP 2 RP:SCP:REP 71->144|2raqA1|4e-11|16.4|73/93|d.58.61.1| RP:SCP:REP 139->194|1dkgA1|1e-19|39.3|56/59|b.73.1.1| HM:SCP:REP 39->138|1dkgB2|7e-25|45.0|100/0|h.1.9.1|1/1|Coiled-coil domain of nucleotide exchange factor GrpE| HM:SCP:REP 139->197|1dkgA1|4.9e-18|49.2|59/59|b.73.1.1|1/1|Head domain of nucleotide exchange factor GrpE| OP:NHOMO 1164 OP:NHOMOORG 1056 OP:PATTERN -------------------------1111111111--------2211111111--------111---1 111-211----11------------------------11-11--111--11-111-1111--11--1111111111111111111111111111111--111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111211111111111111111111111111111121111111111111111111-11112111111121111121111111111111111111111111111111111111111111111--111111111111111111111211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--11111111111111111111111111111111111111111111111111111111111111-1111111-11111111111111111-11-111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111--11111111111111111111111111111111111111111111111111111111111111111111111111111111111111--11--1-----1---1----1-1111111111 1111111-521-111111-111111111111111111111111111111111111111111111111111111111111111111111-12111111111111211--512111-23222112222121352-233121221231211212123222221111111-121111122322F2222243451621111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 158 STR:RPRED 81.0 SQ:SECSTR #####################################ccHTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTccHHEEEEEHHHHHHHHHHHHHHHHHHTTTEEEEccccccccTTTEEEEEEEEcccccTTcEEEEcccEEEETTEEEEcEEEEEEEc PSIPRED ccccccccHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcccEEEccccccccHHHHHHHHEEEcccccccEEEEEEcccEEEccEEccccEEEEEcc //