[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : grxA
DDBJ      :grxA         glutaredoxin 1
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  86/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:86 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->77 1egoA PDBj 1e-11 43.2 %
:RPS:PDB   1->77 1aazA PDBj 2e-12 26.0 %
:RPS:SCOP  1->72 1h75A  c.47.1.1 * 5e-14 28.1 %
:HMM:SCOP  1->80 1abaA_ c.47.1.1 * 2.7e-17 36.2 %
:RPS:PFM   3->69 PF00462 * Glutaredoxin 8e-09 40.0 %
:HMM:PFM   3->69 PF00462 * Glutaredoxin 3.5e-18 35.0 60/60  
:BLT:SWISS 1->77 GLRX1_SHIFL 4e-11 43.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31039.1 GT:GENE grxA GT:PRODUCT glutaredoxin 1 GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1232416..1232676 GB:FROM 1232416 GB:TO 1232676 GB:DIRECTION + GB:GENE grxA GB:PRODUCT glutaredoxin 1 GB:PROTEIN_ID ACD31039.1 GB:DB_XREF GI:187712742 GB:GENE:GENE grxA LENGTH 86 SQ:AASEQ MKIKIYTRNGCPYCVWAKQWFEENNIAFDETIIDDYAQRSKFYDEMNQSGKVIFPISTVPQIFIDDEHIGGFTELKANADKILNKK GT:EXON 1|1-86:0| BL:SWS:NREP 1 BL:SWS:REP 1->77|GLRX1_SHIFL|4e-11|43.2|74/85| BL:PDB:NREP 1 BL:PDB:REP 1->77|1egoA|1e-11|43.2|74/85| RP:PDB:NREP 1 RP:PDB:REP 1->77|1aazA|2e-12|26.0|77/87| RP:PFM:NREP 1 RP:PFM:REP 3->69|PF00462|8e-09|40.0|60/60|Glutaredoxin| HM:PFM:NREP 1 HM:PFM:REP 3->69|PF00462|3.5e-18|35.0|60/60|Glutaredoxin| GO:PFM:NREP 3 GO:PFM GO:0009055|"GO:electron carrier activity"|PF00462|IPR002109| GO:PFM GO:0015035|"GO:protein disulfide oxidoreductase activity"|PF00462|IPR002109| GO:PFM GO:0045454|"GO:cell redox homeostasis"|PF00462|IPR002109| RP:SCP:NREP 1 RP:SCP:REP 1->72|1h75A|5e-14|28.1|64/76|c.47.1.1| HM:SCP:REP 1->80|1abaA_|2.7e-17|36.2|80/0|c.47.1.1|1/1|Thioredoxin-like| OP:NHOMO 95 OP:NHOMOORG 86 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------1--------11-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--------1-------1--1---------1----------------------------------------------------------------------------------------------------------------------------------11-----------------------------------------1--1-1-1111111111-111111111111111111------1111111111111-1111111-11111--1-------------1-----------------------------------------------------------222222222--11111111------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 81 STR:RPRED 94.2 SQ:SECSTR EEEccTTTcccHHHHHHHHHHHHTTccEEEEEccTcccHHHHHHHHHHHTccccTTccccEEEcTccEEEcHHHHHHHHHH##### PSIPRED cEEEEEEccccHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHcccccccccccEEEEccEEEEcHHHHHHHHHcHHHcc //