[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : gshB
DDBJ      :gshB         glutathione synthase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  433/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
c.30.1d.142.1
:324 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->313 1gsaA PDBj 8e-85 45.8 %
:RPS:PDB   14->321 1ce8A PDBj 1e-20 11.0 %
:RPS:SCOP  1->121 1glvA1  c.30.1.3 * 3e-26 40.0 %
:RPS:SCOP  123->312 1glvA2  d.142.1.1 * 1e-15 43.4 %
:HMM:SCOP  1->122 1gsaA1 c.30.1.3 * 7.1e-40 43.8 %
:HMM:SCOP  123->314 1gsaA2 d.142.1.1 * 6.9e-58 35.9 %
:RPS:PFM   1->120 PF02951 * GSH-S_N 3e-30 46.2 %
:RPS:PFM   124->293 PF02955 * GSH-S_ATP 3e-48 51.5 %
:HMM:PFM   124->299 PF02955 * GSH-S_ATP 1.5e-71 49.1 175/176  
:HMM:PFM   1->120 PF02951 * GSH-S_N 4e-42 42.0 119/119  
:BLT:SWISS 1->315 GSHB_ECOLI 2e-84 45.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30825.1 GT:GENE gshB GT:PRODUCT glutathione synthase GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 965268..966242 GB:FROM 965268 GB:TO 966242 GB:DIRECTION + GB:GENE gshB GB:PRODUCT glutathione synthase GB:PROTEIN_ID ACD30825.1 GB:DB_XREF GI:187712528 GB:GENE:GENE gshB LENGTH 324 SQ:AASEQ MKVGFIIDNLNSFNISKDSTYMMLHAAQDKGWEIYTFYPNDLSIINGKPKGDALKIKIHKTKQDWYEILSQRHDFSLLDLDCIFMRKDPPFNMEYIYVTYMLDLAKKNYVLVVNNPQALRDFNEKVAISNYPKFAPHTLITRSYKQINEFYEKHKDIIVKPLDGMGGSSIFRIKEGDKNKNVILEILTQHQSRYIMVQDYQKAIKEGDKRILIVNGEPIKYLLARVPSDSDNRGNLAAGATAEVRELQDSDYKIAKKVAKKLKKEGVMFAGIDVIGDKLTEVNITSPTGIQEIYKATKINAASLLMQAVEKKINKMRQEHENGE GT:EXON 1|1-324:0| BL:SWS:NREP 1 BL:SWS:REP 1->315|GSHB_ECOLI|2e-84|45.5|314/316| SEG 253->264|kiakkvakklkk| BL:PDB:NREP 1 BL:PDB:REP 1->313|1gsaA|8e-85|45.8|312/314| RP:PDB:NREP 1 RP:PDB:REP 14->321|1ce8A|1e-20|11.0|300/1058| RP:PFM:NREP 2 RP:PFM:REP 1->120|PF02951|3e-30|46.2|119/119|GSH-S_N| RP:PFM:REP 124->293|PF02955|3e-48|51.5|169/176|GSH-S_ATP| HM:PFM:NREP 2 HM:PFM:REP 124->299|PF02955|1.5e-71|49.1|175/176|GSH-S_ATP| HM:PFM:REP 1->120|PF02951|4e-42|42.0|119/119|GSH-S_N| GO:PFM:NREP 5 GO:PFM GO:0004363|"GO:glutathione synthase activity"|PF02951|IPR004215| GO:PFM GO:0006750|"GO:glutathione biosynthetic process"|PF02951|IPR004215| GO:PFM GO:0004363|"GO:glutathione synthase activity"|PF02955|IPR004218| GO:PFM GO:0005524|"GO:ATP binding"|PF02955|IPR004218| GO:PFM GO:0006750|"GO:glutathione biosynthetic process"|PF02955|IPR004218| RP:SCP:NREP 2 RP:SCP:REP 1->121|1glvA1|3e-26|40.0|120/122|c.30.1.3| RP:SCP:REP 123->312|1glvA2|1e-15|43.4|173/177|d.142.1.1| HM:SCP:REP 1->122|1gsaA1|7.1e-40|43.8|121/0|c.30.1.3|1/1|PreATP-grasp domain| HM:SCP:REP 123->314|1gsaA2|6.9e-58|35.9|192/192|d.142.1.1|1/1|Glutathione synthetase ATP-binding domain-like| OP:NHOMO 451 OP:NHOMOORG 436 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------1---1-------------------------------------------------------11-------------------------1----1----------1111111111111111111111111111111111111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111111111-11111111111112211121112211111111111111111111111111111111111111111---------------1111111111111111111111111111111111111111111-1111111111111111111111111111111111111----------------------------11---------------------------111111111111111111112111121221121-1-11111-11111111111111111111-11111111111111111111111111111111111111111111111111111111111111111--1111111111111111---------------1111111111111111111111111111111111111121112111111112211111111111111111-------------------------------------------------------- ---------------1---------------------------------------------------------------------------------------------------------------------------------------------------2------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 321 STR:RPRED 99.1 SQ:SECSTR EEEEEEEEcccTHTHHHHHHHHHHHHHHHTTcEEEEEcccTTcGGGcGcccGGGcGGGccEEEcccccHHHHHHHHHHcccEEEccccHHHHHHHHHHHHHTTHHHHTcEEccccHHHHHHHHcHHHHHHTTcccccEEEEccHHHHHHHHHHHccEEEEETTccTTTTcEEEccHHHHHHHHHHHHHHcTTccEEEEEccTTcEEEEEEEEEcTTccEEEEEEEEEcccTTccTTcccEEEccccccHHHHHHHHHHHHHHTcccEEEEEEEEEETTEEEEEccccHHHHHHHHHHccHHHHHHHHHTTccGGGcccGGG### PSIPRED cEEEEEEccHHHccccccHHHHHHHHHHHcccEEEEEEHHHEEEEccEEEEEEEEEEEEEcccccEEEEEccccccHHHccEEEEEccccccHHHHHHHHHHHHHHHcccEEEEcHHHHHHHHHHHHHHHcccccccEEEEccHHHHHHHHHHHccEEEEEccccccEEEEEEccccccHHHHHHHHHHHccccEEEEEcccccccccEEEEEEccEEEEEEEEEEcccccEEEEEEcccEEEEEEccHHHHHHHHHHHHHHHHcccEEEEEEEEccEEEEEEccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccc //