[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : guaA
DDBJ      :guaA         GMP synthase (glutamine-hydrolyzing)
Swiss-Prot:GUAA_FRATM   RecName: Full=GMP synthase [glutamine-hydrolyzing];         EC=6.3.5.2;AltName: Full=Glutamine amidotransferase;AltName: Full=GMP synthetase;

Homologs  Archaea  64/68 : Bacteria  854/915 : Eukaryota  191/199 : Viruses  0/175   --->[See Alignment]
c.23.16c.26.2d.52.2
:516 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   3->516 1gpmA PDBj e-167 59.1 %
:RPS:PDB   8->195 2a9vB PDBj 2e-41 32.8 %
:RPS:PDB   216->516 2dplA PDBj 6e-56 45.9 %
:RPS:SCOP  3->195 1gpmA2  c.23.16.1 * 2e-41 51.3 %
:RPS:SCOP  216->395 1gpmA1  c.26.2.1 * 1e-30 65.2 %
:RPS:SCOP  396->516 1gpmA3  d.52.2.1 * 1e-30 71.1 %
:HMM:SCOP  7->228 1l9xA_ c.23.16.1 * 5.2e-59 37.3 %
:HMM:SCOP  184->438 2nsyA_ c.26.2.1 * 2.4e-59 34.6 %
:HMM:SCOP  396->516 1gpmA3 d.52.2.1 * 3.6e-48 61.2 %
:RPS:PFM   11->188 PF00117 * GATase 9e-25 36.2 %
:RPS:PFM   217->393 PF02540 * NAD_synthase 1e-09 29.8 %
:RPS:PFM   424->515 PF00958 * GMP_synt_C 6e-30 60.9 %
:HMM:PFM   11->191 PF00117 * GATase 6.6e-44 30.9 181/192  
:HMM:PFM   424->515 PF00958 * GMP_synt_C 5.2e-42 65.2 92/93  
:HMM:PFM   205->285 PF02540 * NAD_synthase 6.6e-13 32.5 80/242  
:BLT:SWISS 1->516 GUAA_FRATM 0.0 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30863.1 GT:GENE guaA GT:PRODUCT GMP synthase (glutamine-hydrolyzing) GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1013554..1015104 GB:FROM 1013554 GB:TO 1015104 GB:DIRECTION + GB:GENE guaA GB:PRODUCT GMP synthase (glutamine-hydrolyzing) GB:PROTEIN_ID ACD30863.1 GB:DB_XREF GI:187712566 GB:GENE:GENE guaA LENGTH 516 SQ:AASEQ MTDIHNHKILILDFGSQYTQLIARRVREVDVFCEIFPHDVAADFIKNYQAKGIILSGGPESVYDSDVKAPEIVFELGVPVLGICYGMQTMVMQHGGEVKGADQSEFGKAIINILNSTNNIFSNMEHEQLVWMSHSDKVTQTGEHFEIIASSTNAPVAAVAHKNKPFFGVQFHPETTHTENGKQIIENFVVNICGCDTLWNIENIIENDIKEIKQKVGTDKVILGLSGGVDSSVVAAILHQAIGDQLTCIFVDTGLLRLNEDDQVMQVFAEHMDINVIRINAKNRFLDALRGICDPEQKRKIIGKLFVDIFDEEAAKIENAKWLAQGTIYSDVIESAGNNQSKAHVIKSHHNVGGLPKEMKLKLLEPLRELFKDEVRKLGLGLGLPYNMLYRHPFPGPGLGVRILGEIKKEYVETLQKADAIFTEELYKHNLYHDVSQAFGVFLPVKSVGVVGDQRRYEYVIALRAVVSIDFMTATWANLPYDFLSLVSNRIVNEVKQVSRVVYDVTGKPPGTIEWE GT:EXON 1|1-516:0| SW:ID GUAA_FRATM SW:DE RecName: Full=GMP synthase [glutamine-hydrolyzing]; EC=6.3.5.2;AltName: Full=Glutamine amidotransferase;AltName: Full=GMP synthetase; SW:GN Name=guaA; OrderedLocusNames=FTM_0931; SW:KW ATP-binding; Complete proteome; Glutamine amidotransferase;GMP biosynthesis; Ligase; Nucleotide-binding; Purine biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->516|GUAA_FRATM|0.0|100.0|516/516| GO:SWS:NREP 6 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0006541|"GO:glutamine metabolic process"|Glutamine amidotransferase| GO:SWS GO:0006177|"GO:GMP biosynthetic process"|GMP biosynthesis| GO:SWS GO:0016874|"GO:ligase activity"|Ligase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006164|"GO:purine nucleotide biosynthetic process"|Purine biosynthesis| SEG 200->215|nieniiendikeikqk| SEG 355->370|lpkemklklleplrel| BL:PDB:NREP 1 BL:PDB:REP 3->516|1gpmA|e-167|59.1|492/501| RP:PDB:NREP 2 RP:PDB:REP 8->195|2a9vB|2e-41|32.8|183/195| RP:PDB:REP 216->516|2dplA|6e-56|45.9|270/287| RP:PFM:NREP 3 RP:PFM:REP 11->188|PF00117|9e-25|36.2|177/185|GATase| RP:PFM:REP 217->393|PF02540|1e-09|29.8|161/208|NAD_synthase| RP:PFM:REP 424->515|PF00958|6e-30|60.9|92/93|GMP_synt_C| HM:PFM:NREP 3 HM:PFM:REP 11->191|PF00117|6.6e-44|30.9|181/192|GATase| HM:PFM:REP 424->515|PF00958|5.2e-42|65.2|92/93|GMP_synt_C| HM:PFM:REP 205->285|PF02540|6.6e-13|32.5|80/242|NAD_synthase| GO:PFM:NREP 8 GO:PFM GO:0003824|"GO:catalytic activity"|PF00117|IPR000991| GO:PFM GO:0003952|"GO:NAD+ synthase (glutamine-hydrolyzing) activity"|PF02540|IPR003694| GO:PFM GO:0005524|"GO:ATP binding"|PF02540|IPR003694| GO:PFM GO:0009435|"GO:NAD biosynthetic process"|PF02540|IPR003694| GO:PFM GO:0003922|"GO:GMP synthase (glutamine-hydrolyzing) activity"|PF00958|IPR001674| GO:PFM GO:0005524|"GO:ATP binding"|PF00958|IPR001674| GO:PFM GO:0006164|"GO:purine nucleotide biosynthetic process"|PF00958|IPR001674| GO:PFM GO:0006177|"GO:GMP biosynthetic process"|PF00958|IPR001674| RP:SCP:NREP 3 RP:SCP:REP 3->195|1gpmA2|2e-41|51.3|193/205|c.23.16.1| RP:SCP:REP 216->395|1gpmA1|1e-30|65.2|158/175|c.26.2.1| RP:SCP:REP 396->516|1gpmA3|1e-30|71.1|121/121|d.52.2.1| HM:SCP:REP 7->228|1l9xA_|5.2e-59|37.3|220/0|c.23.16.1|1/1|Class I glutamine amidotransferase-like| HM:SCP:REP 184->438|2nsyA_|2.4e-59|34.6|234/271|c.26.2.1|1/1|Adenine nucleotide alpha hydrolases-like| HM:SCP:REP 396->516|1gpmA3|3.6e-48|61.2|121/0|d.52.2.1|1/1|GMP synthetase C-terminal dimerisation domain| OP:NHOMO 2109 OP:NHOMOORG 1109 OP:PATTERN 2212--3233333333-312211353334555333333333332222323333333223222231-23 2221212222211121111-1222121111111222123221222211122222211122121221223212222111112212212222332211-11112231112321-------111111-22112212122222222222223412222222213112222244422212222222222231132122233333333233333322222233322233333333332222222222222222223323121211212222211111111-13332222222222222222222222222222222222211222111133123111111111122322222212112222233323222323222122222222211111223112232221222222222222-33233332222122222222222222222122111112122222222222122231111122111---------------111122221322222222222222222222222222222222222222222222222232222222222222222222222133421211121111222222222112123232222233333213111111122222112133221222133333222333333223332-21211------12121112222222222-222222222222222222222223231222222222222222212222222112111111111112323221223333212332222121143222322222232113122222111322122122232223333213333222223322211212121111111222133222211111-1-1------1------1------1------1121121222232 1111111-311-2211111111111112211111111232223111211222221111111121221211222222212221112111-21111231111311322-1412111111112111112-11251-11211111-1111111-1111111112641111111123322122192112333352831244331 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 514 STR:RPRED 99.6 SQ:SECSTR ##cTccccEEEEEccccTTcHHHHHHHHTTccccEEETTccGGGGTTccccEEEEccccGGGTGGGHHHHHHHHHccccEEEEEEccccHHHHHccTTcccccccccccEEEEETTEEEEEEccccccccEEEEEEEEHHHHHHHHHHcHHHHHHHHHTHHHHHccEEEEEccccccccccccccccccTTccccHHHHHHHHHHHHHHHHHHHHHTTccEEEEccccHHHHHHHHHHHHHHGGGEEEEEEEcccccTTHHHHHHHHHTTTTccEEEEEEcHHHHHHHTTTcccHHHHHHHHHHHHHHHHHHHHHHHHTccEEEcccccccccETTcccccccTTcccEEccTTTcccEEccEEcTTTTccHHHHHHHHHHTTccHHHHTcccccTTGGGGGccccccHHHHHHHHHHHHHHHHHHHHTTccccEEEEEEEEccccEEEEccccEEEEEEEEEEEEEcccccccEEccccHHHHHHHHHHHHHHcTTEEEEEEcccccTTcccccc PSIPRED cccccccEEEEEEccccHHHHHHHHHHHcccEEEEEcccccHHHHHHccccEEEEccccccHHHccccHHHHHHHccccEEEEcHHHHHHHHHHccEEEEcccccccccccEEEEccccEEccccccEEEEEEEcEEEEEcccccEEEEEEccccEEEEEEccccEEEEEcccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHccccccEEEEEEcccHHHHHHHHHHHHHccccEEEEEEcccccccccHHHHHHHHHHHcccEEEEEcHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccccEEEEccccccEEEcccccccccEEEEEccccccccHHcccEEEcHHHHHHHHHHHHHHHHHcccHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccEEEcccccccccccccccccEEEEEEEEccccccccHHHccHHHHHHHHHHHHcccccccEEEEccccccccccccc //