[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : hemA
DDBJ      :hemA         glutamyl-tRNA reductase
Swiss-Prot:HEM1_FRATW   RecName: Full=Glutamyl-tRNA reductase;         Short=GluTR;         EC=1.2.1.70;

Homologs  Archaea  56/68 : Bacteria  590/915 : Eukaryota  20/199 : Viruses  0/175   --->[See Alignment]
a.151.1c.2.1d.58.39
:414 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->385 1gpjA PDBj 3e-33 26.5 %
:RPS:PDB   83->221 2eggB PDBj 3e-12 16.8 %
:RPS:SCOP  3->157 1gpjA3  d.58.39.1 * 5e-38 31.4 %
:RPS:SCOP  168->327 1omoA  c.2.1.13 * 2e-09 12.0 %
:HMM:SCOP  1->157 1gpjA3 d.58.39.1 * 3.2e-42 41.5 %
:HMM:SCOP  158->309 1gpjA2 c.2.1.7 * 1.7e-28 27.8 %
:HMM:SCOP  310->411 1gpjA1 a.151.1.1 * 4.9e-21 33.7 %
:RPS:PFM   6->155 PF05201 * GlutR_N 2e-32 41.3 %
:RPS:PFM   178->262 PF01488 * Shikimate_DH 2e-08 34.1 %
:RPS:PFM   313->410 PF00745 * GlutR_dimer 5e-10 33.7 %
:HMM:PFM   7->156 PF05201 * GlutR_N 2.3e-47 40.7 150/152  
:HMM:PFM   171->298 PF01488 * Shikimate_DH 5.1e-31 35.2 128/135  
:HMM:PFM   313->411 PF00745 * GlutR_dimer 2e-20 32.3 99/101  
:BLT:SWISS 1->414 HEM1_FRATW 0.0 100.0 %
:PROS 98->121|PS00747|GLUTR

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30308.1 GT:GENE hemA GT:PRODUCT glutamyl-tRNA reductase GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 254915..256159 GB:FROM 254915 GB:TO 256159 GB:DIRECTION + GB:GENE hemA GB:PRODUCT glutamyl-tRNA reductase GB:PROTEIN_ID ACD30308.1 GB:DB_XREF GI:187712011 GB:GENE:GENE hemA LENGTH 414 SQ:AASEQ MALISLAIDYKKSPIEVRSEFALSGLDVSMLYRSILAIDNVVHAVILSTCNRTEVYLEISDLRVVDDILVWWQGYVRNPNYKIKDYFKLRQGTEVIMHLMKLACGLESMVLGEPQILGQVKDSYTLSKKNHAIGKELDRVFQKVFATAKRVRSETRIGHCPVSVAFSAITLAKRQLDNISSKNVLIIGAGQTGELLFRHVTALAPKQIMLANRTIEKAQKITSAFRNASAHYLSELPQLIKKADIIIAAVNVLEYIVTCKYVGDKPRVFIDISIPQALDPKLGELEQNVYYCVDDINAVIEDNKDKRKYESSKAQKIIVKSLEEYLEKEKAIISNSAIKELFQKADGLVDLSLEKSLAKIRNGKDAEEIIKRFAYEIKKKVLHYPVVGMKEASKQGRSDCLVCMKRMFGLNVEK GT:EXON 1|1-414:0| SW:ID HEM1_FRATW SW:DE RecName: Full=Glutamyl-tRNA reductase; Short=GluTR; EC=1.2.1.70; SW:GN Name=hemA; OrderedLocusNames=FTW_0258; SW:KW Complete proteome; NADP; Oxidoreductase; Porphyrin biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->414|HEM1_FRATW|0.0|100.0|414/414| GO:SWS:NREP 3 GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0006779|"GO:porphyrin biosynthetic process"|Porphyrin biosynthesis| PROS 98->121|PS00747|GLUTR|PDOC00608| BL:PDB:NREP 1 BL:PDB:REP 3->385|1gpjA|3e-33|26.5|359/399| RP:PDB:NREP 1 RP:PDB:REP 83->221|2eggB|3e-12|16.8|137/166| RP:PFM:NREP 3 RP:PFM:REP 6->155|PF05201|2e-32|41.3|150/152|GlutR_N| RP:PFM:REP 178->262|PF01488|2e-08|34.1|85/115|Shikimate_DH| RP:PFM:REP 313->410|PF00745|5e-10|33.7|98/101|GlutR_dimer| HM:PFM:NREP 3 HM:PFM:REP 7->156|PF05201|2.3e-47|40.7|150/152|GlutR_N| HM:PFM:REP 171->298|PF01488|5.1e-31|35.2|128/135|Shikimate_DH| HM:PFM:REP 313->411|PF00745|2e-20|32.3|99/101|GlutR_dimer| GO:PFM:NREP 11 GO:PFM GO:0008883|"GO:glutamyl-tRNA reductase activity"|PF05201|IPR015895| GO:PFM GO:0033014|"GO:tetrapyrrole biosynthetic process"|PF05201|IPR015895| GO:PFM GO:0050661|"GO:NADP or NADPH binding"|PF05201|IPR015895| GO:PFM GO:0055114|"GO:oxidation reduction"|PF05201|IPR015895| GO:PFM GO:0004764|"GO:shikimate 5-dehydrogenase activity"|PF01488|IPR006151| GO:PFM GO:0005737|"GO:cytoplasm"|PF01488|IPR006151| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01488|IPR006151| GO:PFM GO:0008883|"GO:glutamyl-tRNA reductase activity"|PF00745|IPR015896| GO:PFM GO:0033014|"GO:tetrapyrrole biosynthetic process"|PF00745|IPR015896| GO:PFM GO:0050661|"GO:NADP or NADPH binding"|PF00745|IPR015896| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00745|IPR015896| RP:SCP:NREP 2 RP:SCP:REP 3->157|1gpjA3|5e-38|31.4|140/143|d.58.39.1| RP:SCP:REP 168->327|1omoA|2e-09|12.0|158/320|c.2.1.13| HM:SCP:REP 1->157|1gpjA3|3.2e-42|41.5|142/0|d.58.39.1|1/1|Glutamyl tRNA-reductase catalytic, N-terminal domain| HM:SCP:REP 158->309|1gpjA2|1.7e-28|27.8|151/0|c.2.1.7|1/1|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 310->411|1gpjA1|4.9e-21|33.7|101/102|a.151.1.1|1/1|Glutamyl tRNA-reductase dimerization domain| OP:NHOMO 706 OP:NHOMOORG 666 OP:PATTERN 11-1-11111111111-1122111111111111111111111111111111111-------111--22 1211111111111111111-1111111111111111111111111-1-1---111-1-11111-1111111--------111111111-----------11211111111---------1----11111111111111111---11111111111111111111111111111111111111111111---11111111111111111111111111111111111111111111111111111111111111-------------11---------------------------------------------1---------11111-------1-11-111111211---1-2111111--1111--1-11-11--------------------------------------------------------------------------------------1-1-----------------------------------11111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111122221111111111111111111111111111111111111111111111111111111111111--11111------11111111111111111-1111111111111111111111111111111111111-111111111111111111111111111---111111111111111111111-----11111111111111111111111111111111111111111111111111111111111111111111111111----------------------------------------------11-----111 ------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------1111I111113124-3311----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 383 STR:RPRED 92.5 SQ:SECSTR ##EEEEEEEEcTTTEEEEEEEEccccTTTcccccEEEEEEETTccccEEEEEETccccGGGHHHHHHHHHHHHHHHccccEEHHHHHHHHTTccEEEEEEEccTTHHHHHHHHTHHHTccEEEEcTTcTTTTGGcEEcHHHHHHTcccEEEEETTEEEEEccHHHHHHHHHHHHTTcccTTTccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHTcEEETcEEccGGGGGGccEEEEcccTTccccccGGGcccccEEEEccccccccHHHHHHHHTTcEEEccHHHHHHHHHHHHHTHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccTHHHHHHHHHHHHHHHHHccc############################# DISOP:02AL 414-415| PSIPRED cEEEEEEEEcccccHHHHHHHcccHHHHHHHHHHHHcccccccEEEEccccEEEEEEEcccHHHHHHHHHHHHHHccccHHHHHHHHHHHccHHHHHHHHHHHHcccHHHcccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccccccEEEEEccHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHcccccEEEHHHHHHHHHHccEEEEccccccccccHHHHHcccEEEEEccccccccHHHHccccEEEEEHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccc //