[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : hemG
DDBJ      :hemG         protoporphyrinogen oxidase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  27/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.3.1
:394 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   338->389 2iveB PDBj 6e-04 26.9 %
:RPS:PDB   24->388 2b9wA PDBj 1e-08 12.8 %
:RPS:SCOP  22->239,341->389 2ivdA1  c.3.1.2 * 3e-12 18.8 %
:HMM:SCOP  2->259 1o5wA1 c.3.1.2 * 1.8e-20 23.4 %
:RPS:PFM   22->91 PF01593 * Amino_oxidase 5e-05 31.4 %
:HMM:PFM   16->89 PF01593 * Amino_oxidase 1.1e-08 24.3 74/449  
:BLT:SWISS 73->169 NISB_LACLA 3e-04 26.1 %
:BLT:SWISS 184->227 TRXB_METJA 7e-04 47.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30969.1 GT:GENE hemG GT:PRODUCT protoporphyrinogen oxidase GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1143080..1144264 GB:FROM 1143080 GB:TO 1144264 GB:DIRECTION + GB:GENE hemG GB:PRODUCT protoporphyrinogen oxidase GB:PROTEIN_ID ACD30969.1 GB:DB_XREF GI:187712672 GB:GENE:GENE hemG LENGTH 394 SQ:AASEQ MTDTKHFDTIIIGAGISGISLAQRLTAASVKNCVFEANKVGGCIDSQQYEDFWFEMGAHTIYNSYNKTIEYIHSNSLGKDIQPRKKLPFLFVQPNNKIQSIFININPFTAALSFLKNRKVSKQDKTVSKYATKLFGKKNYSKTLKYCFDAVLSQDSQEFPMEYLFKKYDRDTTLPRSFTLKNGLAELFKNHNENVIKETVIKITKQQKWHIHTKHGEYTCENLCLATPWNVTELLLEKILPNIAKHQYRPTMSNLISVGIVTNKSSLKHIKNLAGLIGKEQFFYSTVSRDVIDNPNYRAIVFHCRDEFSQEELLDKIIELLKIKPDHIIYTYTKNNTLPCYHRKHSAFIADLEKELQNQPNLYISGNFFDRLAIENCIRRSNEQAGKIIQNKIP GT:EXON 1|1-394:0| BL:SWS:NREP 2 BL:SWS:REP 73->169|NISB_LACLA|3e-04|26.1|92/993| BL:SWS:REP 184->227|TRXB_METJA|7e-04|47.7|44/100| SEG 10->20|iiigagisgis| SEG 311->324|eelldkiiellkik| BL:PDB:NREP 1 BL:PDB:REP 338->389|2iveB|6e-04|26.9|52/450| RP:PDB:NREP 1 RP:PDB:REP 24->388|2b9wA|1e-08|12.8|358/423| RP:PFM:NREP 1 RP:PFM:REP 22->91|PF01593|5e-05|31.4|70/426|Amino_oxidase| HM:PFM:NREP 1 HM:PFM:REP 16->89|PF01593|1.1e-08|24.3|74/449|Amino_oxidase| RP:SCP:NREP 1 RP:SCP:REP 22->239,341->389|2ivdA1|3e-12|18.8|262/341|c.3.1.2| HM:SCP:REP 2->259|1o5wA1|1.8e-20|23.4|205/0|c.3.1.2|1/1|FAD/NAD(P)-binding domain| OP:NHOMO 27 OP:NHOMOORG 27 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------11111111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1---1--1111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 386 STR:RPRED 98.0 SQ:SECSTR ccTTcEEEEEEEcccHHHHHHHHHHHHTTcccEEEccccccTTccccEETTEEcccccccccTTcHHHHHHHHHHccccEEcGGGcTTHHHHHHHHHHHHHHHHHTTTTTTTcccccccccGGGGccHHHHHHHTTcGGGHHHHTTTTcccccccTTTccHHHHccHHHHHHHHHTcccccTTHHHHHHHccccccccccEEEccTTcEEEEEcccEEEEcEEEEcccHHHHTTcccccHHHHHHHTTcEEEEE###EEEEEEEccccccEEEcGGGGcGGGTTcccEEEEccTTcTTccEEEEEHHHHHHHHHHHHHHTTccEEEEEEEEEEEEccHHHHHTTHHHHHHHHHHHTTTGGGEEEccGGGccccHHHHHHHHHHHHHHHH##### PSIPRED ccccccccEEEEcccHHHHHHHHHHHHccccEEEEEccccccEEEEEEEccEEEEEcccEEccccHHHHHHHHHccccccEEEcccEEEEEEcccccccccccccHHHHHHHHHHHccccccccccHHHHHHHHHcHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHcccEEEccccEEEEEEcccEEEEEEEEEEccHHHHHHHHccccccHHHHHcccccccEEEEEEEEcccccccccccEEEEEEcccccccccccccccccccHHcccccHHHcHHHHHHHHHHHHccccccEEEEEEcccccccccccHHHHHHHHHHHHHHcccEEEEEcccccccHHHHHHHHHHHHHHHHHHccc //