[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : hitA
DDBJ      :hitA         histidine triad (HIT) family protein
Swiss-Prot:             

Homologs  Archaea  47/68 : Bacteria  831/915 : Eukaryota  174/199 : Viruses  0/175   --->[See Alignment]
d.13.1
:112 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->104 1xquB PDBj 4e-26 47.1 %
:RPS:SCOP  3->105 1av5A  d.13.1.1 * 9e-27 46.6 %
:HMM:SCOP  1->110 1emsA1 d.13.1.1 * 6.7e-35 47.3 %
:RPS:PFM   14->102 PF01230 * HIT 1e-17 46.5 %
:HMM:PFM   12->104 PF01230 * HIT 3.5e-29 46.7 90/98  
:BLT:SWISS 3->111 YHIT_AQUAE 2e-32 53.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30531.1 GT:GENE hitA GT:PRODUCT histidine triad (HIT) family protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(564707..565045) GB:FROM 564707 GB:TO 565045 GB:DIRECTION - GB:GENE hitA GB:PRODUCT histidine triad (HIT) family protein GB:PROTEIN_ID ACD30531.1 GB:DB_XREF GI:187712234 GB:GENE:GENE hitA LENGTH 112 SQ:AASEQ MSDCIFCKIITGEIPSKKVYKDENIFAFHDINPAADVHILVIPKKHIASLNDLTEQDQELMGKFILSIPKVAKLMGLKGFKTIFNTGKEGGQMVFHLHAHILGGKIRSKLPE GT:EXON 1|1-112:0| BL:SWS:NREP 1 BL:SWS:REP 3->111|YHIT_AQUAE|2e-32|53.2|109/121| BL:PDB:NREP 1 BL:PDB:REP 1->104|1xquB|4e-26|47.1|104/113| RP:PFM:NREP 1 RP:PFM:REP 14->102|PF01230|1e-17|46.5|86/97|HIT| HM:PFM:NREP 1 HM:PFM:REP 12->104|PF01230|3.5e-29|46.7|90/98|HIT| RP:SCP:NREP 1 RP:SCP:REP 3->105|1av5A|9e-27|46.6|103/113|d.13.1.1| HM:SCP:REP 1->110|1emsA1|6.7e-35|47.3|110/160|d.13.1.1|1/1|HIT-like| OP:NHOMO 1232 OP:NHOMOORG 1052 OP:PATTERN 11-1--1-111111121111111-1111-11----11111111------1111-1111---111-211 11--2--1------21111-12--11111111111122111---1-111111-----1112111122111111111111112111111111--1--1-----------1-111111111111111111111111111111111112111111111111111111111111111111111111111111--1111111111111111111112211111111111111111121111111111111111111111111111111111111111111112211111111111111111111111111111111111111111111111111111111111111111111111111111111111211111111113112111-1-1111111211111111111111111--11-11111111-1111-111111111111112111111111111111-1111111111111111111------11----1111111111112212111111111111111111111111222111-1-111222111111111111111111111111212-11111---111111111111121111111111111111111111111111111111--1111111111111111111111111111111-1111111-11111111111111111111-1111111111111111111111111121211111111111111111111111111111111111111111111111111111111111111111111111111111111-2222121121111111111111111111111111111111111111111111111211111112211111111---11111-1-11111---11111111111-11-----111 1111211-311111-1111-11111-111-1-111111111111-1-11-1111111-11-1-11111-111111-1----1111111-324112211-1111211-231421323-2142-2247-22293-2252122412322112122131122221214222234211421112E1111133361342222211 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 105 STR:RPRED 93.8 SQ:SECSTR ccccHHHHHHTTcccccEEEEcccEEEEEcccccccEEEEEEEccccccGGGccTTGGGHHHHHHHHHHHHHHHTTcTcEEEEccccTTTTcccccccEEEEEcc####### PSIPRED ccccHHHHHHccccccEEEEEcccEEEEEcccccccEEEEEEEccccccHHHccHHHHHHHHHHHHHHHHHHHHcccccEEEEEEccHHHccEEEEEEEEEEcccccccccc //