[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : holA
DDBJ      :holA         DNA polymerase III, delta subunit
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  150/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.80.1c.37.1
:325 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   20->306 1jr3D PDBj 1e-09 19.2 %
:RPS:SCOP  18->133 1jqlB  c.37.1.20 * 2e-15 15.5 %
:RPS:SCOP  206->317 1jqjC1  a.80.1.1 * 1e-16 24.5 %
:HMM:SCOP  1->205 1jr3D2 c.37.1.20 * 1.5e-15 19.5 %
:HMM:SCOP  206->324 1jr3D1 a.80.1.1 * 5.5e-24 36.1 %
:RPS:PFM   21->184 PF06144 * DNA_pol3_delta 5e-08 27.2 %
:RPS:PFM   208->317 PF12169 * DNA_pol3_gamma3 8e-04 28.6 %
:HMM:PFM   21->184 PF06144 * DNA_pol3_delta 1.3e-25 25.8 163/172  
:HMM:PFM   219->269 PF02414 * Borrelia_orfA 8.6e-06 23.5 51/289  
:HMM:PFM   249->296 PF03834 * Rad10 0.00016 31.2 48/69  
:BLT:SWISS 20->306 HOLA_ECOLI 4e-09 19.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31445.1 GT:GENE holA GT:PRODUCT DNA polymerase III, delta subunit GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1759550..1760527 GB:FROM 1759550 GB:TO 1760527 GB:DIRECTION + GB:GENE holA GB:PRODUCT DNA polymerase III, delta subunit GB:PROTEIN_ID ACD31445.1 GB:DB_XREF GI:187713148 GB:GENE:GENE holA LENGTH 325 SQ:AASEQ MELSYFELLQKNDLTAYKLFIITGDEPLQKHNTIEKITNQFKTKNFEISYHDLSEQNIDVLYNEVDSLSLFSIDKFIQFNFDKPPQKKLQQTLVDKLINDDDNVYLLVFSGMKKQNTSAKWFQSLEHKAIHIRIFQPNLDNAINIIDYETQQLSLSLTKEATQLLALKTEGNLIATKQILKLLSRQDSRVFDENTIRPFLHEHANFDVFDLSEAILSQHKSKALKILNSILNENDKPPLVLWALKRELRILSQLKNTQITYHQKIFKDNNIWSAKQKFYISLANKLSPEKISAGLEKCLDTDLCIKGARKGNIQLKLNEIVFDIF GT:EXON 1|1-325:0| BL:SWS:NREP 1 BL:SWS:REP 20->306|HOLA_ECOLI|4e-09|19.2|286/343| BL:PDB:NREP 1 BL:PDB:REP 20->306|1jr3D|1e-09|19.2|286/338| RP:PFM:NREP 2 RP:PFM:REP 21->184|PF06144|5e-08|27.2|162/168|DNA_pol3_delta| RP:PFM:REP 208->317|PF12169|8e-04|28.6|105/136|DNA_pol3_gamma3| HM:PFM:NREP 3 HM:PFM:REP 21->184|PF06144|1.3e-25|25.8|163/172|DNA_pol3_delta| HM:PFM:REP 219->269|PF02414|8.6e-06|23.5|51/289|Borrelia_orfA| HM:PFM:REP 249->296|PF03834|0.00016|31.2|48/69|Rad10| GO:PFM:NREP 4 GO:PFM GO:0003677|"GO:DNA binding"|PF06144|IPR010372| GO:PFM GO:0003887|"GO:DNA-directed DNA polymerase activity"|PF06144|IPR010372| GO:PFM GO:0006260|"GO:DNA replication"|PF06144|IPR010372| GO:PFM GO:0009360|"GO:DNA polymerase III complex"|PF06144|IPR010372| RP:SCP:NREP 2 RP:SCP:REP 18->133|1jqlB|2e-15|15.5|116/140|c.37.1.20| RP:SCP:REP 206->317|1jqjC1|1e-16|24.5|110/117|a.80.1.1| HM:SCP:REP 1->205|1jr3D2|1.5e-15|19.5|205/211|c.37.1.20|1/1|P-loop containing nucleoside triphosphate hydrolases| HM:SCP:REP 206->324|1jr3D1|5.5e-24|36.1|119/127|a.80.1.1|1/1|DNA polymerase III clamp loader subunits, C-terminal domain| OP:NHOMO 150 OP:NHOMOORG 150 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----111111-----11--------11-1111111111-11111111-111-11-11--111111111-1---------------------------------------------------------1111-1111111111111111----1-11-111--1--1-----------1-----------------------------------11-1------------------------1----------------111111111-1111111-1-------1---1111111111111111111111111-111111111111111111111111111--------------1---------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 287 STR:RPRED 88.3 SQ:SECSTR ###################EEEEEccHHHHHHHHHHHHHHHHHHTccEEEEEEccTTccHHHHHHHHHHHccccEEEEEEcccccTTHHHHHHHHHTTccTTEEEEEEEccccTTTTTcHHHHHHTTTcEEEEEccccTTHHHHHHHHHHHHTTcEEcHHHHHHHHHccTTcHHHHHHHHHHHHHTTcEEcHHHEHHHHHHHHccccHHHHHHHHTTccHHHHHHHHTccTTTTccHHHHHHHHHHHHHHHHHHHTcccccHHHHHHHHTccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHH################### DISOP:02AL 325-326| PSIPRED ccccHHHHHHHHHcccccEEEEEcccHHHHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHcccccccccEEEEEEccccccHHHHHHHHHHHccccccEEEEEEccccccHHHHHHHHHHHcccEEEEcccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccHHHHHHHHHHHHHccccccccHHHHHHHHcccccccHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHc //