[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : holC
DDBJ      :holC         DNA polymerase III, chi subunit
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.128.1
:146 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  1->144 1em8A  c.128.1.1 * 9e-17 22.3 %
:HMM:SCOP  1->146 1em8A_ c.128.1.1 * 9.1e-26 29.8 %
:RPS:PFM   1->140 PF04364 * DNA_pol3_chi 5e-12 34.6 %
:HMM:PFM   1->140 PF04364 * DNA_pol3_chi 1.8e-20 30.3 132/137  
:BLT:SWISS 44->130 HOLC_HAEIN 2e-04 28.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31372.1 GT:GENE holC GT:PRODUCT DNA polymerase III, chi subunit GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1663943..1664383) GB:FROM 1663943 GB:TO 1664383 GB:DIRECTION - GB:GENE holC GB:PRODUCT DNA polymerase III, chi subunit GB:PROTEIN_ID ACD31372.1 GB:DB_XREF GI:187713075 GB:GENE:GENE holC LENGTH 146 SQ:AASEQ MMKIEFKVLQTQDINQMLEVLITEVVKEYALQKTIAILAPAGIAKQLDDKLWQDGQDSFIPHHCAINAREYNQYNNIPILITDNLFITSGYDVLINIMDVAVDPQRVKVKELKEFVYQQDSALQASRKKYVYYKKSNLEIITVQDN GT:EXON 1|1-146:0| BL:SWS:NREP 1 BL:SWS:REP 44->130|HOLC_HAEIN|2e-04|28.9|83/144| RP:PFM:NREP 1 RP:PFM:REP 1->140|PF04364|5e-12|34.6|133/137|DNA_pol3_chi| HM:PFM:NREP 1 HM:PFM:REP 1->140|PF04364|1.8e-20|30.3|132/137|DNA_pol3_chi| GO:PFM:NREP 3 GO:PFM GO:0003677|"GO:DNA binding"|PF04364|IPR007459| GO:PFM GO:0003887|"GO:DNA-directed DNA polymerase activity"|PF04364|IPR007459| GO:PFM GO:0006260|"GO:DNA replication"|PF04364|IPR007459| RP:SCP:NREP 1 RP:SCP:REP 1->144|1em8A|9e-17|22.3|139/147|c.128.1.1| HM:SCP:REP 1->146|1em8A_|9.1e-26|29.8|141/147|c.128.1.1|1/1|DNA polymerase III chi subunit| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 146-147| PSIPRED ccEEEEEEEccccHHHHHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHHcccccccccccccccccccccccccccEEEEcccccccccEEEEEccccccccccccccEEEEEccccHHHHHHHHHHHHHHHHcccccEEEEcc //